DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and cfp-1

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001023214.1 Gene:cfp-1 WormBaseID:WBGene00009924 Length:508 Species:Caenorhabditis elegans

Alignment Length:525 Identity:95/526 (18%)
Similarity:152/526 (29%) Gaps:229/526 (44%)


  Fly    38 CDNCNEWFH-GDCIGLPANIGEQHDTYYCTECFRKNPL------------LKCTYKKS------- 82
            |..||:..: |.|  .|...|:..|   ..:||....|            ||....|:       
 Worm    20 CIRCNDEKNCGTC--WPCRNGKTCD---MRKCFSAKRLYNEKVKRQTDENLKAIMAKTAQREAAH 79

  Fly    83 -PSTTGVPKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARIINSIGVRQNPRRRSTFVQERPSEVP 146
             .:||..|..|...:.....|.....|...|......|:           :|::..:.|| ..||
 Worm    80 QAATTTAPSAPVVIEQQVEKKKRGRKKGSGNGGAAAAAQ-----------QRKANIINER-DYVP 132

  Fly   147 N-PSRQSTKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKKNPKPEDKVTDDAQKPAVEKLFESK 210
            | |:||                     :..|.:.|:|  :.|.:|:                   
 Worm   133 NRPTRQ---------------------QSADLRRKRT--QLNAEPD------------------- 155

  Fly   211 GTQCNMFRDWSKYVPPENSKKRGTCFTVFCQQLARSCSRYCCDECGNFTA---ITNVFALGLLPN 272
                               |....|....|...:|..|:||.||||...|   :|.:     |||
 Worm   156 -------------------KHPRQCLNPNCIYESRIDSKYCSDECGKELARMRLTEI-----LPN 196

  Fly   273 MPAMKVAMGHVGLLLGNDLTNNQKSNKNSEASESKTETKPKVKKPKSEGRKSRYRSPSSSLERSP 337
                                                    :.|:...||.....||         
 Worm   197 ----------------------------------------RCKQYFFEGPSGGPRS--------- 212

  Fly   338 DVSRTAAKRPKLQEELPSSSSRSSRKLVEESRSETERHKAKHKTSKKEKTSSQRAYSLSPIPSPK 402
                       |::|:....::.:|::.:.:.||.......:|..:..||.    ..|.|:.:.:
 Worm   213 -----------LEDEIKPKRAKINREVQKLTESEKNMMAFLNKLVEFIKTQ----LKLQPLGTEE 262

  Fly   403 SYRAARNTSETA-----PNSPVNLKKTFKQKHVISSPTGKKRVCRSQTISADDPLPSQPKSTEVS 462
            .|  ..|..|..     |:.|: ||.|   ||:        .:|.:::..|              
 Worm   263 RY--DDNLYEGCIVCGLPDIPL-LKYT---KHI--------ELCWARSEKA-------------- 299

  Fly   463 PMASAGTSSSNKKPVPETSCQKYRKLSFTDENCEKIKIIRCIVSNMSPTEKALLARKRMMMKLAS 527
              .|.|....|....   .|:||.  |.|:..|:::|       ::.|..:          ||..
 Worm   300 --ISFGAPEKNNDMF---YCEKYD--SRTNSFCKRLK-------SLCPEHR----------KLGD 340

  Fly   528 EQHIR 532
            |||::
 Worm   341 EQHLK 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 8/31 (26%)
cfp-1NP_001023214.1 zf-CpG_bind_C 188..435 CDD:289071 47/280 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002408
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46174
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1383
TreeFam 00.000 Not matched by this tool.
33.130

Return to query results.
Submit another query.