DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and nurf-1

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_496995.3 Gene:nurf-1 WormBaseID:WBGene00009180 Length:2197 Species:Caenorhabditis elegans

Alignment Length:51 Identity:18/52 (35%)
Similarity:29/52 (56%) Gaps:1/52 (2%)


  Fly    22 VYCICRQSHIN-GFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRK 71
            :||:|::.:.: .|.:.||:|..|||.:|:|......||...|.|..|.|:
 Worm  1963 LYCVCQKPYDDTKFYVGCDSCQGWFHPECVGTTRAEAEQAADYNCPACTRE 2013

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 16/46 (35%)
nurf-1NP_496995.3 DDT 196..256 CDD:214726
PHD 350..389 CDD:214584
TNG2 1745..1953 CDD:227367
PHD_SF 1904..1950 CDD:304600
PHD2_3_BPTF 1964..2010 CDD:277035 16/46 (35%)
Bromo_gcn5_like 2052..2137 CDD:99941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.