DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and DIDO1

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_011526806.1 Gene:DIDO1 HGNCID:2680 Length:2276 Species:Homo sapiens

Alignment Length:691 Identity:134/692 (19%)
Similarity:216/692 (31%) Gaps:255/692 (37%)


  Fly    22 VYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIG----EQHDTYYCTEC-------------- 68
            :||||||.|.|.||||||.|.|||||||:|:....|    ...:.|.|..|              
Human   269 LYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQDETHSETA 333

  Fly    69 ---------------------------------------------------FRKNP--------- 73
                                                               |:..|         
Human   334 DQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPGPGPVPTQLPV 398

  Fly    74 --------------------LLKCTYKKSPS---------------------------------- 84
                                .:.|...::|.                                  
Human   399 LWQVLEIAVSRSISAFTLLHCISCKVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILKHAAATMK 463

  Fly    85 --TTGVPKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARIINSIGVRQNPRRRSTFVQERPSEVPN 147
              ::|..:.|| || .|....|:.|..||..  .:....|:|:..|..|.::.|.|::   .|..
Human   464 FLSSGKEQKPK-PK-EKMKMKPEKPSLPKCG--AQAGIKISSVHKRPAPEKKETTVKK---AVVV 521

  Fly   148 PSRQSTKLQKAVNYENATEEPTEDAEKVDQKPKKTA----------KKKNPKPEDKVTDDA---- 198
            |:| |..|.|....|::|.....|......||:|||          .|::.:.|:|....|    
Human   522 PAR-SEALGKEAACESSTPSWASDHNYNAVKPEKTAAPSPSLLYKSTKEDRRSEEKAAAMAASKK 585

  Fly   199 ---------QKPAVEKLFESKGTQCNMF-------------------RDWSKYVPPEN---SKKR 232
                     ::||...|...|.:..|:.                   |.|....|...   :::.
Human   586 TAPPGSAVGKQPAPRNLVPKKSSFANVAAATPAIKKPPSGFKGTIPKRPWLSATPSSGASAARQA 650

  Fly   233 GTCFTVFCQQLARSCSRYCCDECGNFTAITNVFALGLLPNMPAMKVAMGHVGLLLGNDLTNNQKS 297
            |.         |.:.:.....:.....|:.......::|::|....|.|.:|.:.......|.:.
Human   651 GP---------APAAATAASKKFPGSAALVGAVRKPVVPSVPMASPAPGRLGAMSAAPSQPNSQI 706

  Fly   298 NKNSEA------------SESKTETKPKVKK-------------PKSEGR-KSRYRS-------P 329
            .:|...            |:....|:.:|.|             ..::.| ||:|||       |
Human   707 RQNIRRSLKEILWKRVNDSDDLIMTENEVGKIALHIEKEMFNLFQVTDNRYKSKYRSIMFNLKDP 771

  Fly   330 SSS------LERSPDVSRTAAKRPK--LQEELPSSSSRSSRKLVEESRSETERHKAKHKTSKKEK 386
            .:.      |.....:::....:|:  :.:||.:...|.:|.::|   |.|:.|....||:.:::
Human   772 KNQGLFHRVLREEISLAKLVRLKPEELVSKELSTWKERPARSVME---SRTKLHNESKKTAPRQE 833

  Fly   387 TSSQRAYSLSPIPSPKSYRAARNTSE--TAPNSPV---NLKKTFKQ--KHVISSPTGKKRVCRSQ 444
            .......|.....|.:...:||...|  |||...|   .||.|..|  .|:...   ..::|..|
Human   834 AIPDLEDSPPVSDSEEQQESARAVPEKSTAPLLDVFSSMLKDTTSQHRAHLFDL---NCKICTGQ 895

  Fly   445 TISA-DDPLPSQPK---STEVSPMASAGTSSSNKKPVPETS 481
            ..|| |:|.|.:.|   |.:...:.|...||: ..|.|:::
Human   896 VPSAEDEPAPKKQKLSASVKKEDLKSKHDSSA-PDPAPDSA 935

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 26/49 (53%)
DIDO1XP_011526806.1 TNG2 <160..302 CDD:227367 23/33 (70%)
PHD_DIDO1_like 266..319 CDD:277109 26/50 (52%)
TFS2M 708..809 CDD:128786 16/101 (16%)
SPOC 1093..1199 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.