DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and si:ch73-181d5.4

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_003201203.2 Gene:si:ch73-181d5.4 ZFINID:ZDB-GENE-100922-118 Length:2142 Species:Danio rerio

Alignment Length:573 Identity:117/574 (20%)
Similarity:192/574 (33%) Gaps:208/574 (36%)


  Fly    19 SKDVYC-ICRQ-SHINGFMICCDNCNEWFHGDCIGLPANIGE--QHDTYYCTECFRKNPLLKCTY 79
            ::|..| .|.| ...|...|.|.:|..:.|.||:|    |.|  :::.|.|..| .:|..|.|..
Zfish   204 NQDAVCGTCGQRDDSNRLTISCKSCGAFRHVDCVG----IFETWKNEEYMCPPC-TENRELTCRN 263

  Fly    80 KK-------------------------------SP-------STTGVPKTP-------------- 92
            :|                               ||       |:..:|::.              
Zfish   264 QKTDDPCLKQEISSINMVDVQQMIKVEQNVVEVSPKCIGPGCSSDALPESVYCGHRCIVQHAAVA 328

  Fly    93 -KTPKTPKTPKNPKTPKTPKNSKTPKTARIINSIGVRQNP--RRRSTFVQERPSE------VPNP 148
             ||...||.........:.|:.|....|::. .:.|.::|  |.:....:|:..|      |.:|
Zfish   329 IKTLSEPKPEVKSAVVPSLKSEKRSFLAKLF-KVKVNKSPAEREQEGKAEEKSEESVCSSAVADP 392

  Fly   149 SRQSTKLQKAVNYENAT-----EEPTEDAEKVDQKPKKTAKKKNPKPEDKVTDDAQKPAVEKLFE 208
            ::.:|          ||     :.|.:|:..||..|.......:..|:|..:.: :.||...|.:
Zfish   393 AQTTT----------ATPPEHHKLPVKDSSDVDPAPLCMKSPPSGLPQDAPSSE-KAPAAPLLKK 446

  Fly   209 SKGTQCNMFRDWSKYVPPENSKKRGTCFTVFCQQLARSCSRYCCDECGNFTAITNVFALGLLPNM 273
            |               .|..:||                                     .:|..
Zfish   447 S---------------TPARAKK-------------------------------------TMPGS 459

  Fly   274 PAMKVAMGHVGLLLGNDLTNNQKSNKNSEASESKTETKPKVKKPKSEGRKSRYRSPSSSLERSPD 338
            |.:::..   |.|..:.|.:.:||      |:|...|:..::.|....     |:|..| .::|:
Zfish   460 PRLELLK---GALSKSPLASLKKS------SDSSRTTEVSIRAPVVSA-----RAPEVS-SKAPE 509

  Fly   339 VSRTAAKRPKLQEELPSSSSRSSRKLVEESRSETERHKAKHKTSKKEKTSSQRAYSLSPIPSPKS 403
            ||   :..|::...:|..|||:.    |...|..|       .|.|....|.||..:        
Zfish   510 VS---SGPPEVPVRVPEISSRAP----EVPASFLE-------VSSKAPEVSVRAPEI-------- 552

  Fly   404 YRAARNTSETAPNSPVNLKKTFKQKHVISSPTGKKRVCRSQTISADDPLPSQPKSTEVSPMASAG 468
                   |..||..||:..|...:...|||        |:..:    |:.:...|...|.::|..
Zfish   553 -------SSRAPEVPVSALKVSVRAPEISS--------RAPEV----PVSALKVSVRASEISSRA 598

  Fly   469 TSSSNKKPVPETSCQKYRKLSFTDENCEKIKI---IRCIVSNMSPTEKALLAR 518
            .:||.   |||.| .:..::|..|..|..:.|   |||:::      |.||.|
Zfish   599 PASSG---VPEVS-SRSPEVSVLDPRCSPLLIRQNIRCLLT------KVLLER 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 15/49 (31%)
si:ch73-181d5.4XP_003201203.2 PHD_SHPRH 211..253 CDD:277022 14/46 (30%)
TFIIS_M 626..717 CDD:284835 8/23 (35%)
PHA03255 820..>963 CDD:165513
SPOC 983..1089 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.