DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and bptf

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_012822736.1 Gene:bptf XenbaseID:XB-GENE-6054434 Length:3038 Species:Xenopus tropicalis

Alignment Length:172 Identity:42/173 (24%)
Similarity:66/173 (38%) Gaps:48/173 (28%)


  Fly    18 SSKD--VYCICRQSHING-FMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCTY 79
            |.||  :||||:..:... |.|.||.|..||||.|:|:..:..:..|.|.|.:|           
 Frog  2855 SKKDNKIYCICKTPYDESKFYIGCDRCQNWFHGRCVGILQSEADYIDEYVCPQC----------- 2908

  Fly    80 KKSPSTTGVPKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARIINSIGVRQNPRRRSTFVQERPSE 144
                         ::.:...|..:|.|.|..:..|     |::.|:   |:.:....| ||....
 Frog  2909 -------------QSTEDAMTVLSPLTDKDYEGLK-----RVLRSL---QSHKMAWPF-QEPVDP 2951

  Fly   145 VPNPSRQSTKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKK 186
            |..|           :|....:||. |...::::.|....||
 Frog  2952 VDAP-----------DYYGVIKEPM-DLSTIEERIKTRFYKK 2981

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 18/46 (39%)
bptfXP_012822736.1 DDT 202..258 CDD:280886
WHIM1 300..349 CDD:292246
PHD1_BPTF 353..395 CDD:277034
Med15 2092..>2549 CDD:255446
PHD2_3_BPTF 2862..2908 CDD:277035 18/46 (39%)
Bromo_gcn5_like 2924..3024 CDD:99941 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.