DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and Rapgef2

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_011238578.1 Gene:Rapgef2 / 76089 MGIID:2659071 Length:1657 Species:Mus musculus


Alignment Length:484 Identity:91/484 - (18%)
Similarity:176/484 - (36%) Gaps:151/484 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 STDS-ESADECGLELGESGADSREAGAGGGAGLQVAQGGIFSLDPGHL--TAETALLG------- 114
            |.|| ..|.|.||:.|:   ...|........:|:::......:..||  |.:|.|..       
Mouse   576 SVDSCSKATEAGLKRGD---QILEVNGQNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTR 637

  Fly   115 ---------------GNIRYRRRHSAEQLSAYDLE--MGFQQL-ELGTTISVGPKNE-----DLV 156
                           |:|:...|:|...| |.|:|  :|.::: :.....:||.:|:     |..
Mouse   638 LSEEKRNGAPHLPKIGDIKKASRYSIPDL-AVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKT 701

  Fly   157 QYDV-PKNPHKRSQCDINFESSVLGSGGIMYINGRI-VSGPLDS----LIET------------- 202
            :..: |:.|:.......:.:.|::|.....:|...: |||.|.|    |:::             
Mouse   702 RISILPQKPYNDIGIGQSQDDSIVGLRQTKHIPAALPVSGTLSSSNPDLLQSHHRILDFSTTPDL 766

  Fly   203 -----------------LLPKD------VVDLDKEFVFS-----FLLSCRLFLRPHELL--GRLL 237
                             ::.||      |:...:||..:     :.| |.:.:.|..::  .||.
Mouse   767 PDQVLRVFKADQQSRYIMISKDTTAKEVVIQAIREFAVTATPEQYSL-CEVSVTPEGVIKQRRLP 830

  Fly   238 DSVPESECLESLVSLLAEWTMKFPYDYRDERMMSHVKHIVARCSNSHLEAAVSQTLSALLKRLTD 302
            |.:.:   |...:.|...:.:|  .:...|.:          ||:...:..:.::..:||:..|.
Mouse   831 DQLSK---LADRIQLSGRYYLK--NNMETETL----------CSDEDAQELLRESQISLLQLSTV 880

  Fly   303 LERHEADLRACQTNDKSGPETPLNCPTATQYAQIVCRVEKKLAKHIGGEEFLQCSSMILLDKQKK 367
            ....:..:|..:......|         |:|...:.:::.|.:          |:::      ||
Mouse   881 EVATQLSMRNFELFRNIEP---------TEYIDDLFKLKSKTS----------CANL------KK 920

  Fly   368 WDQPSTSGAPPGAQDPKKTCNLETYLDWSARLRLFVCNEILQSVGIEGRSRTVELWSGVAQYCLL 432
            :::               ..|.||:  |       |.:|||:......|.:.::.:..:|.:|..
Mouse   921 FEE---------------VINQETF--W-------VASEILRETNQLKRMKIIKHFIKIALHCRE 961

  Fly   433 VGNYNSATAILESLESPAIARLKITWSKL 461
            ..|:||..||:..|....:|||:.||.||
Mouse   962 CKNFNSMFAIISGLNLAPVARLRTTWEKL 990

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 22/150 (15%)
RasGEF 334..>473 CDD:279011 28/128 (22%)
Rapgef2XP_011238578.1 CAP_ED 37..143 CDD:237999
cNMP 297..412 CDD:197516
RasGEFN 428..541 CDD:214571
PDZ_signaling 545..625 CDD:238492 13/51 (25%)
degP_htrA_DO <565..689 CDD:273938 24/116 (21%)
RA_PDZ-GEF1 769..851 CDD:340483 14/87 (16%)
RasGEF 874..1099 CDD:238087 35/166 (21%)
PHA03379 <1522..>1643 CDD:223066
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.