DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and rapgef6

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001361718.1 Gene:rapgef6 / 733941 XenbaseID:XB-GENE-981546 Length:1644 Species:Xenopus tropicalis


Alignment Length:489 Identity:89/489 - (18%)
Similarity:163/489 - (33%) Gaps:151/489 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LELGESGADSREAGAGGGAGLQVAQGGIFSL-----------DPGHL--TAETAL-----LGGNI 117
            :|..|.|:.:.|||...|..:....|..|..           :..||  |.:|.:     |...|
 Frog   558 IESVEPGSKATEAGLKRGDQIMEVNGQNFETIVYAKALEILKNNTHLSITVKTNIFVFKELLNRI 622

  Fly   118 RYRRRHSAEQL-----------SAYDLEMGFQQL---------ELGTTISVGPKNE-----DLVQ 157
            ...:::....:           |..||....:|:         ....|:| |.:|.     |..:
 Frog   623 GQEKKNGVPHIPKIAEKKNNRYSIPDLPNDVEQMFPRDRASKKMKANTVS-GGRNRIRKILDKTR 686

  Fly   158 YDV-PKNPHKRSQCDINFESSVLG------SGGIMYINGRIVSGPLDSLIETLLPKDVVDLDKEF 215
            :.: |..|........:.:.|::|      |..||.|.|.:.|...|.|..|   .:::|.....
 Frog   687 FSILPPKPFSDGHVIQSQDDSIVGTRQCRHSVAIMPIPGTLSSSSPDLLQAT---TNILDFSNPT 748

  Fly   216 VFSFLL----SCRLFLRPHE----LLGRLLDSVPESECLESLVSLLAEWTMKFPYD--------- 263
            .|.|..    ..|:|....:    ::|:      ::...|.::..|.|:::....|         
 Frog   749 AFGFYYIPDQVIRIFKADQQCCYIIIGK------DTTAKEVVIQALHEFSLTGSTDTYSLCEVSV 807

  Fly   264 -----YRDERMMSHVKHIVAR------------------CSNSHLEAAVSQTLSALLKRLTDLER 305
                 .:..|:...:..:..|                  ||:...:..:.::|.:||:..|....
 Frog   808 SPEGVIKQRRLPDQLSKLADRIQLNGRYYLKNNMETETLCSDEDAQELLRESLISLLQLSTIEVA 872

  Fly   306 HEADLRACQTNDKSGPETPLNCPTATQYAQIVCRVEKKL-AKHIGGEEFLQCSSMILLDKQKKWD 369
            .:..:|..:......|         |:|...:.:::.|. |.|:  ::|                
 Frog   873 TQLSMRDFELFRNIEP---------TEYIDDLFKIDSKTSAAHL--KQF---------------- 910

  Fly   370 QPSTSGAPPGAQDPKKTCNLETYLDWSARLRLFVCNEILQSVGIEGRSRTVELWSGVAQYCLLVG 434
                          ::..|.||:  |       |..|||:......|.:.|:.:...|.:|....
 Frog   911 --------------EEVINQETF--W-------VATEILREPNHLKRMKIVKHFIKTALHCRECR 952

  Fly   435 NYNSATAILESLESPAIARLKITWSKLQVTCQQL 468
            |:||..||:..|....:|||:.||.||....::|
 Frog   953 NFNSMFAIISGLNLAPVARLRGTWEKLPSKYEKL 986

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 20/143 (14%)
RasGEF 334..>473 CDD:279011 30/136 (22%)
rapgef6NP_001361718.1 CAP_ED 37..119 CDD:381773
CAP_ED 280..380 CDD:237999
RasGEFN 412..525 CDD:214571
PDZ_signaling 528..609 CDD:238492 12/50 (24%)
RA_PDZ-GEF1 758..840 CDD:340483 9/87 (10%)
RasGEF 863..1097 CDD:214539 37/174 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.