DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and Rapgef3

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_038935756.1 Gene:Rapgef3 / 59326 RGDID:621869 Length:1003 Species:Rattus norvegicus


Alignment Length:474 Identity:98/474 - (20%)
Similarity:160/474 - (33%) Gaps:139/474 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RDRDKCHHGHHQHHRRHHRRRCRISSNSSSTDSESADECGLELGESGADSREAGAGGGAGLQVAQ 95
            |||        ::|.|.||:.|        :..|..|.. |.|| .|..||....|      :.|
  Rat   148 RDR--------KYHLRLHRQCC--------SGRELVDGI-LALG-LGVHSRSQAVG------ICQ 188

  Fly    96 GGIFSLDPG---HLTAETALLGGNIRYRRRHSAEQLSAYDLEMGFQQLELGTTISV-GPKNEDLV 156
               ..||.|   |:..:......:.::.|....|...|...::..:.:|....:|. ||  :.|:
  Rat   189 ---VLLDEGALCHVKHDWTFQDRDAQFYRFPGPEPQPAGTHDVEEELVEAMALLSQRGP--DALL 248

  Fly   157 QYDVPKNPHKRS--QCDINFESSVLGSGGIMYINGRIVSGPLDSLIETLLPKDVVDLDKEFVFSF 219
            ...:.|:|.:|:  :.|:.||                         |.|..|.|..|....... 
  Rat   249 TVALRKSPGQRTDEELDLIFE-------------------------ELLHIKAVAHLSNSVKRE- 287

  Fly   220 LLSCRLFLRPHELLGRLLDSVPESECL---------------ESLVSLLAEWTMKFPYDYRDERM 269
             |:..|...||...|.:|.|..:....               :.||:.|.|..     |:....:
  Rat   288 -LAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGLVTTLHEGD-----DFGQLAL 346

  Fly   270 MSHVKH---IVARCSNSHLEAAVSQTLSALLK----RLTDLERH-EADLRACQTNDKSGPETPLN 326
            ::....   |:.|.:|.|......|..:.::|    :...||.| :..|...:|:..:||..| .
  Rat   347 VNDAPRAATIILRENNCHFLRVDKQDFNRIIKDVEAKTMRLEEHGKVVLVLERTSQGAGPSRP-P 410

  Fly   327 CPTATQYAQIVCRVEKKL-----------AKHIGGEEFLQ-----------CSSMILLDKQKKWD 369
            .|...:|..:....||.|           :.|...|.||.           |:.:..........
  Rat   411 TPGRNRYTVMSGTPEKILELLLEAMRPDSSAHDPTETFLSDFLLTHSVFMPCTQLFAALLHHFHV 475

  Fly   370 QPSTSGAPPGAQDPKKTCNLETYLDWSARLRLFVCNEILQSVGIEGRSRTVELWSGVAQYCLLVG 434
            :||   .|.|..:.:::    ||          :||:..|.:      |.|..|  ||.|..::.
  Rat   476 EPS---EPAGGSEQERS----TY----------ICNKRQQIL------RLVSRW--VALYSPMLR 515

  Fly   435 NYNSATAILESLESPAIAR 453
            :...||:.|:.| |..::|
  Rat   516 SDPVATSFLQKL-SDLVSR 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 23/125 (18%)
RasGEF 334..>473 CDD:279011 29/142 (20%)
Rapgef3XP_038935756.1 DEP_Epac 131..254 CDD:239884 30/134 (22%)
CAP_ED 278..387 CDD:237999 19/115 (17%)
RasGEF_N 418..527 CDD:395493 26/133 (20%)
RasGEF 738..1003 CDD:214539
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.