DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and rasgrf1

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_009291904.1 Gene:rasgrf1 / 568885 ZFINID:ZDB-GENE-090311-28 Length:1263 Species:Danio rerio


Alignment Length:388 Identity:79/388 - (20%)
Similarity:130/388 - (33%) Gaps:120/388 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 NEDLVQYD----------VPKNPHKRSQCDINFESSVLGSGGIMYINGRIVSG--PLD------- 197
            :.|.:|.|          .|..| |..:|..:.|.|:..     |.||.::|.  .||       
Zfish   833 DNDQIQSDEAEAEVSPTKSPTTP-KNVKCKNSSEFSLFS-----YNNGMVMSSCRELDNNRSALS 891

  Fly   198 -------------------------SLIETLLPKDVVDLDKEFVFSFLLSCRLFLRPHELLGRLL 237
                                     ||..|..|.|..:.|||||.....:.|             
Zfish   892 AASAFAIATAGANEGTPTKEKYRRMSLASTGFPTDQRNGDKEFVIRRAATNR------------- 943

  Fly   238 DSVPESECLESLVSLLAEWTMKFPYDYRDE-----RMMSHVKHIVARCSNSHLEAAVSQTLSA-- 295
                       ::::|..|..|...|:...     :::|.::.::      |....::|...|  
Zfish   944 -----------VLNVLRHWVSKHSQDFETNTELKMKVISFLEEVM------HDPELLTQERKAAA 991

  Fly   296 -LLKRLTDLERHEADLRACQTN----DKSGPETPLNCPTATQYAQIVCRVEKKLAKHIGGEEFLQ 355
             :::.||  :....|.:.|...    .:.|........:|.:.|:.:..::..:.|.|..|||..
Zfish   992 NIIRTLT--QEDPGDNQICLEEVLQMAEGGKSESFENHSALEIAEQLTLLDHLVFKVIPYEEFFG 1054

  Fly   356 CSSMILLDKQKKWDQPSTSGAPPGAQDP---KKTCNLETYLDWSARLRLFVCNEILQSVGIEGRS 417
             ...:..||.:|              .|   |.|.:.....|       .:..|||:...:..|.
Zfish  1055 -QGWMKNDKNEK--------------TPYIMKTTKHFNDISD-------LIATEILRCEDVNVRV 1097

  Fly   418 RTVELWSGVAQYCLLVGNYNSATAILESLESPAIARLKITWSKL-QVTCQQLDCMQRHAEGHG 479
            ..:|.|..||..|..:.|||:...|..||...:|.|||.||.|: :.|...:|.:|:.....|
Zfish  1098 AVMEKWVAVADICRCLHNYNAVLEITSSLNRSSIFRLKKTWLKVSKQTKTVIDKLQKLVSSEG 1160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 21/143 (15%)
RasGEF 334..>473 CDD:279011 37/142 (26%)
rasgrf1XP_009291904.1 PH_RasGRF1_2 19..154 CDD:270081
PH 24..129 CDD:278594
RhoGEF 244..425 CDD:214619
PH-like 474..596 CDD:302622
PH 489..592 CDD:278594
RasGEF_N 643..>691 CDD:279012
REM <928..997 CDD:295342 14/98 (14%)
RasGEF 1024..1261 CDD:214539 40/159 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.