DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and Rgl

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001261814.1 Gene:Rgl / 44115 FlyBaseID:FBgn0026376 Length:973 Species:Drosophila melanogaster


Alignment Length:575 Identity:102/575 - (17%)
Similarity:175/575 - (30%) Gaps:216/575 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QKSRGQRDRDKCHHGHHQHHRRHHRRRCRISSNSSSTDSESADECGLELGESGADSREAGAGGGA 89
            |:.:.|:.:|......|.||....|:|     ..|.|..|....|..........||.|.|    
  Fly    73 QRQQQQQQQDAKDSKRHYHHHTCPRQR-----KKSMTPVEPTHLCQKHQEAKQRRSRSASA---- 128

  Fly    90 GLQVAQGGIFSLDPGHLTAETALLGGNIRYRRRHSAEQLSAYDLEMGFQQLE------------- 141
                                        :.||..|.......|:.......|             
  Fly   129 ----------------------------KPRRNSSYHSYDDLDVSSAVLNAERKVVASLKYLCAC 165

  Fly   142 LGTTI-SVGPKNEDL-------------------------------VQYDVPKNPHKRSQCD--- 171
            .|.|: ::..|.:||                               |:|..| .|...:..|   
  Fly   166 TGATLRNLSKKTKDLHAKNYTYTKPTWRLWGEEHEKNAIFTVYLKKVRYHRP-TPTASNDSDDEI 229

  Fly   172 --INFESSVLGSGGIMYINGRIV-SGPLDSLIETLLPKDVVDLDKEFVFSFLLSCRLFLRPHELL 233
              :.:|:          :..|.| :..|..|:|.|...| .:|:..|:..||.:.|.|..|.::|
  Fly   230 SHLEWET----------VRVRFVKAATLARLVEALATDD-GELESTFINVFLSTYRTFSTPKQVL 283

  Fly   234 ------------------------GRLLD-------SVPESECLESLVSLLAEWTMKFPYDYRDE 267
                                    |:::|       |:.|.. .::|||.|..|...||.|:.::
  Fly   284 SLLTQRYDALHEKHLEELEQAQQNGQVMDPAYDPHASIHEQH-KKTLVSALHVWLDGFPEDWHED 347

  Fly   268 RMMSHVKHIVARCSNSHLEAAVSQTLSALLKRL----------TDLERHE--ADLRACQ------ 314
            .:...:.....|...|.|...|...|..|:|:.          ::...|.  :..|:.|      
  Fly   348 NLQQILAFATKRLKRSDLHIKVLNRLERLIKQSLYGNGGGSGGSENNGHSWLSAARSQQMQQFMI 412

  Fly   315 ----------TNDKSG------------------------PETPLNCPTATQYAQIVCRVE---- 341
                      |:..:|                        |..|:.     .:|:.:.|::    
  Fly   413 PTHYGSSYDLTDQFNGMYLSPMGHGPIYRGPTHFLQAFRFPHVPVR-----HFAEQLTRMDTELF 472

  Fly   342 KKLAKHIGGEEFLQCSSMILLDKQKKWDQPSTSGAPPGAQDPKKTCNLETYLDWSARLRLFVCNE 406
            |:|..|       ||..       ..|.:..:.|:        :|. :.|...::|.|...|.:.
  Fly   473 KRLIPH-------QCLG-------HTWARRDSGGS--------ETV-VATINQFNAVLFRVVSSI 514

  Fly   407 ILQSVGIEGRSRTVELWSGVAQYCLLVGNYNSATAILESLESPAIARLKITWSKL 461
            ::..:..:.|:..:..|..:||...::.|::|..||:.:|.|.:|.||...|..|
  Fly   515 LIDRLKPQERALNISRWIDIAQELRMLKNFSSLKAIISALNSNSIYRLSKIWEVL 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 32/134 (24%)
RasGEF 334..>473 CDD:279011 29/132 (22%)
RglNP_001261814.1 REM 246..378 CDD:100121 31/133 (23%)
RasGEF 454..719 CDD:214539 30/144 (21%)
RalGDS_RA 858..946 CDD:176351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.