DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and ralgps2

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_956768.1 Gene:ralgps2 / 393446 ZFINID:ZDB-GENE-040426-1212 Length:510 Species:Danio rerio


Alignment Length:157 Identity:30/157 - (19%)
Similarity:66/157 - (42%) Gaps:23/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 TATQYAQIVCRVEKKLAKHIGGEEFLQCSSMILLDKQKKWDQPSTSGAPPGAQDPKKTCNLETYL 393
            |..:||..:..::..:.:.|..||...|.          |::.....:.|.|....:..|     
Zfish    49 TPEEYAGQITLMDAPVFRAIQPEELSSCG----------WNKKEKHSSAPNAVAFTRRFN----- 98

  Fly   394 DWSARLRLFVCNEILQSVGIEGRSRTVELWSGVAQYCLLVGNYNSATAILESLESPAIARLKITW 458
                ::..:|..|||.:..::.|:..:.|:...|:....:.:.::..|::.:|:|..|.||..||
Zfish    99 ----QVSFWVVREILHAQTLKIRAEVLSLYIRTAKKLCDMNSLHAVMAVVSALQSAPIFRLTKTW 159

  Fly   459 SKL----QVTCQQLDCMQRHAEGHGHL 481
            :.|    :.|.::|:.:....:.:..|
Zfish   160 ALLSRKDKATFERLEYLMSKEDNYKRL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121
RasGEF 334..>473 CDD:279011 27/142 (19%)
ralgps2NP_956768.1 RasGEF 45..287 CDD:214539 30/157 (19%)
PH-like 462..>504 CDD:302622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.