DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and RGL4

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001316353.1 Gene:RGL4 / 266747 HGNCID:31911 Length:580 Species:Homo sapiens


Alignment Length:184 Identity:44/184 - (23%)
Similarity:71/184 - (38%) Gaps:49/184 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 CQTNDKSGPETPLNCPTATQY-----AQIVCRVEKKLAKHIGGEEFLQCSSMILLDKQKKWDQPS 372
            |:.:.|:.|...|  |..|.:     |:.:..::.:|.|.:...|.|.|.          |.|..
Human   200 CRGSVKNQPSEEL--PDMTTFPPRLLAEQLTLMDAELFKKVVLHECLGCI----------WGQGH 252

  Fly   373 TSGAPPGAQDPKKT---------CNLETYL-DWSARLRLFVCNEILQSVGIEGRSRTVELWSGVA 427
            ..|....|...:.|         |...:.| |.|.|.|              .|:|.||.|..||
Human   253 LKGNEHMAPTVRATIAHFNRLTNCITTSCLGDHSMRAR--------------DRARVVEHWIKVA 303

  Fly   428 QYCLLVGNYNSATAILESLESPAIARLKITWS--------KLQVTCQQLDCMQR 473
            :.||.:.|::|...|:.:|.|..|.:|..||:        :|:..|::...::|
Human   304 RECLSLNNFSSVHVIVSALCSNPIGQLHKTWAGVSSKSMKELKELCKKDTAVKR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121
RasGEF 334..>473 CDD:279011 37/156 (24%)
RGL4NP_001316353.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..215 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.