DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and Rapgef4

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001094112.1 Gene:Rapgef4 / 252857 RGDID:621886 Length:1011 Species:Rattus norvegicus


Alignment Length:326 Identity:66/326 - (20%)
Similarity:109/326 - (33%) Gaps:107/326 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 RLFLRPHELLGRLL--DSVPESECLESLVSLLAEWTMKFPYDYRDERMMSHVKHIVARCSNSHLE 286
            ||.|:...:.|.||  |.|..:...|..||:           ..|.|||...|..:|     .||
  Rat   579 RLVLQWAAMYGDLLQEDDVAMAFLEEFYVSV-----------SDDARMMVAFKEQLA-----ELE 627

  Fly   287 AAVSQTLSALLKRLTDLERHEADLRACQTNDKSGPE---------------------TPLNCPTA 330
            ..|.| :|...|  ...::|:..|:...|.|:...:                     |.:..|.|
  Rat   628 KTVKQ-ISEDAK--APQKKHKVLLQQFNTGDERAQKRQPIRGSDEVLFKVYCIDHTYTTIRVPVA 689

  Fly   331 TQYAQIVCRVEKKLAK---------HIGGEEF------------LQCSSMILLDKQKKWDQ---- 370
            ....:::..|..||..         :.|||:.            |..:..:....::::|.    
  Rat   690 ASVKEVISAVADKLGSGEGLIIVKMNSGGEKVVLKPNDVSVFTTLTINGRLFACPREQFDSLTPL 754

  Fly   371 PSTSGAPPG---------AQD-------------------------------PKKTCNLETYLDW 395
            |...|...|         ::|                               .|.|.||:.:|..
  Rat   755 PEQEGPTTGTVGTFELMSSKDLAYQMTTYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRR 819

  Fly   396 SARLRLFVCNEILQSVGIEGRSRTVELWSGVAQYCLLVGNYNSATAILESLESPAIARLKITWSK 460
            ...::.:|..||.....:..|.:.::.:..:|.:|....|.||..||:..|.:.|::||.:||.|
  Rat   820 FNEIQFWVVTEICLCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEK 884

  Fly   461 L 461
            |
  Rat   885 L 885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 23/77 (30%)
RasGEF 334..>473 CDD:279011 36/193 (19%)
Rapgef4NP_001094112.1 CAP_ED 43..158 CDD:237999
DEP_Epac 206..334 CDD:239884
CAP_ED 356..467 CDD:237999
RasGEF_N 499..605 CDD:366199 8/25 (32%)
RasGEF 768..1009 CDD:214539 25/118 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.