DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and Rasgrf2

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_036013814.1 Gene:Rasgrf2 / 19418 MGIID:109137 Length:1190 Species:Mus musculus


Alignment Length:289 Identity:65/289 - (22%)
Similarity:104/289 - (35%) Gaps:80/289 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 DKEFVFSFLLSCRLFLRPHELLGRLLDSVPESECLESLVSLLAEWTMKFPYDYRDERMMSHVKHI 276
            ||||:.....:.|                        ::::|..|..|...|:.           
Mouse   858 DKEFIIRRTATNR------------------------VLNVLRHWVSKHAQDFE----------- 887

  Fly   277 VARCSNSHLEAAVSQTLSALLKRLTDLERHEAD-----LRACQTNDKSGPETPL-------NCP- 328
                .|:.|:..|...|..:| |..||...|..     |||...:|:......|       :|| 
Mouse   888 ----LNNELKMNVLNLLEEVL-RDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQMTDCPK 947

  Fly   329 -------TATQYAQIVCRVEKKLAKHIGGEEFLQCSSMILLDKQKKWDQPSTSGAPPGAQDPKKT 386
                   :|.:.|:.:..::..:.:.|..||||. ...:.|||.::     |......:|...:.
Mouse   948 AECFETLSAMELAEQITLLDHIVFRSIPYEEFLG-QGWMKLDKNER-----TPYIMKTSQHFNEM 1006

  Fly   387 CNLETYLDWSARLRLFVCNEILQSVGIEGRSRTVELWSGVAQYCLLVGNYNSATAILESLESPAI 451
            .||             |.::|:....|..|:..:|.|..||..|..:.|||....|..:|...||
Mouse  1007 SNL-------------VASQIMNYADISSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAI 1058

  Fly   452 ARLKITWSKL-QVTCQQLDCMQRHAEGHG 479
            .|||.||:|: :.|...:|.:|:.....|
Mouse  1059 YRLKKTWAKVSKQTKALMDKLQKTVSSEG 1087

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 14/87 (16%)
RasGEF 334..>473 CDD:279011 37/139 (27%)
Rasgrf2XP_036013814.1 PH_RasGRF1_2 19..158 CDD:270081
RhoGEF 247..428 CDD:214619
PH 480..588 CDD:214574
RasGEF_N 638..>686 CDD:395493
REM <853..925 CDD:413353 21/106 (20%)
RasGEF 951..1187 CDD:214539 40/156 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.