DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and Rapgef6

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_006532623.1 Gene:Rapgef6 / 192786 MGIID:2384761 Length:1614 Species:Mus musculus


Alignment Length:518 Identity:115/518 - (22%)
Similarity:180/518 - (34%) Gaps:129/518 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IACGTRCK--QTVLQKSRGQRDRDKCHHGHHQHHRRHHRRRCRISSNSSSTDSESADECGLELGE 75
            |||..:.|  |.||||:..:.....|..|                      .||......:|..|
Mouse   520 IACAAKAKWRQVVLQKASRESPLHFCLTG----------------------GSEKGFGVFVEEVE 562

  Fly    76 SGADSREAGAGGGAGLQVAQGGIFSLDPGHLTAETALLGGNIRYRRRHSA-----------EQLS 129
            ||:.:.:||...|..:....|..|.    ::|...||   .|.....|.|           |.||
Mouse   563 SGSKAADAGLKRGDQVMEVNGQNFE----NITLAKAL---EILRNNTHLALTVKTNIFVFKELLS 620

  Fly   130 AYDLE-MGFQQLELGTTISVGPKNEDLVQYDVPKNPHKRSQCDINFESSVLGSGGIMYINGRIVS 193
            ..:.| .|...:   ..|:....|...:| |||.:..:..|           ..|...|....||
Mouse   621 RTEQEKSGVPHI---PKIAEKKSNRHSIQ-DVPGDMEQAPQ-----------EKGNKKIKANTVS 670

  Fly   194 GP-------LDSLIETLLPKDVV-------DLDKEFVFSFLLSCRLFLRPHELLGRLLDSVPESE 244
            |.       ||....::||..:.       ..|...|.:  ..||..|....:.|.|..|.|  :
Mouse   671 GGRNKIRKILDKTRFSILPPKLFSDGGLSQSQDDSIVGT--RHCRHSLAIMPIPGTLSSSSP--D 731

  Fly   245 CLESLVSLL---AEWTMKFPY-------DYRDERMMSHV--------KHIVAR---------CSN 282
            .|:...|:|   ....:.|.|       .::.::...::        |.:|.:         .|:
Mouse   732 LLQPTTSMLDFSNPSAVGFYYIPDQVIRVFKADQQSCYIIISKDTTAKEVVCQAVQEFGLTGASD 796

  Fly   283 SHLEAAVSQTLSALLK--RLTDLERHEADLRACQTND----KSGPETPLNCPTATQYAQIVCRVE 341
            ::....||.|...::|  ||.|.....||  ..|.|.    |:..||...|  :.:.||.:.: |
Mouse   797 TYSLCEVSVTPEGVIKQRRLPDQFSKLAD--RIQLNGRYYLKNNMETETLC--SDEDAQELLK-E 856

  Fly   342 KKLAKHIGGEEFLQCSSMILLDKQKKWDQPSTSGAPPGA------QDPKKTCN--LETYLDWSAR 398
            .:|:       .||.|::.:..:....|........|..      :...||.|  |:.:.|...:
Mouse   857 SQLS-------MLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLDSKTGNTHLKQFEDIVNQ 914

  Fly   399 LRLFVCNEILQSVGIEGRSRTVELWSGVAQYCLLVGNYNSATAILESLESPAIARLKITWSKL 461
            ...:|.:|||.......|.:.::.:..:|.:|....|:||..||:..|....:|||:.||.||
Mouse   915 ETFWVASEILSESNQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLAPVARLRGTWEKL 977

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 25/139 (18%)
RasGEF 334..>473 CDD:279011 34/136 (25%)
Rapgef6XP_006532623.1 CAP_ED 37..>82 CDD:381773
CAP_ED 280..380 CDD:237999
RasGEFN 412..525 CDD:214571 3/4 (75%)
PDZ_signaling 529..609 CDD:238492 24/108 (22%)
RA_PDZ-GEF1 756..838 CDD:340483 15/83 (18%)
RasGEF 862..1086 CDD:238087 30/116 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.