DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and plc-1

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001360638.1 Gene:plc-1 / 181274 WormBaseID:WBGene00004036 Length:3554 Species:Caenorhabditis elegans


Alignment Length:414 Identity:73/414 - (17%)
Similarity:131/414 - (31%) Gaps:160/414 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 QVAQGGIFSLDPGHLTAETALLGGNIRYRRRHSAEQLS--------------------------- 129
            ::..||:.:.|..:|   .|::..|:....|||...:.                           
 Worm  1955 RIGVGGLLNADKINL---VAIVLDNLELFHRHSRTMIKLLEEQAVPPIQIPQNEREQKEKEAKTY 2016

  Fly   130 ---------------------AYDLEMGFQQLELGTTI-------------------SVGPKNED 154
                                 .:||:: .|:|:.|||:                   |.|..|..
 Worm  2017 EPVQVVRGSSHGVALIPLDTLTFDLDV-IQRLQHGTTVIHYEPDSGRSNLCLLRLDPSCGQINWH 2080

  Fly   155 LVQYDVPKNPHKRSQCDINFESSVL---------------------GSGGIMYINGRIVSGPLDS 198
            .:.|.|.|:|.::   |:..:.||.                     |:||:....|.:..    |
 Worm  2081 KISYSVNKDPKEK---DVLAKVSVSNLQPLDSGRGAPSPMPSGRTPGTGGVGVEEGELKL----S 2138

  Fly   199 LIETLLPKDVVDLDKEFVF--------SFLLSC--------------RLFLRPHELLGRLLDSVP 241
            :::.:...|..|:|.|.::        |..:||              ..||.|.::.....:.  
 Worm  2139 VVKGVELVDSYDIDIEAIYRRHSMEEMSVPVSCWKVSHGQLLSDNEFIYFLAPQQIAQFWTNG-- 2201

  Fly   242 ESECLESLVSLLAEWTMKFPYDYRDERMMSHVKHIV---------ARCSNSHLEAAVSQTLSALL 297
                |:|:|..| :...::|     :|.|..:|::.         :.|.....||..:..||   
 Worm  2202 ----LQSVVKSL-QGQQRYP-----DRRMLWIKNVYLSLYEITGESNCGPRPFEALQAFGLS--- 2253

  Fly   298 KRLTDLERHEADLRACQTNDKSGPETPLNCPTATQYAQIVCRVEKKL--AKHIGG-EEFLQCSSM 359
                     :.:..|.:.||.|....|..  ..::...:...::|||  |...|. .:..|..|.
 Worm  2254 ---------QTNTNATRPNDSSLSSEPGG--AKSRLKNLKNAMQKKLRGASREGSRSQSPQPHSP 2307

  Fly   360 ILLDKQKKWDQPSTSGAPPGAQDP 383
            ::.....| .|.|:...|||...|
 Worm  2308 LVRPPSIK-SQISSQSGPPGPNSP 2330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 24/134 (18%)
RasGEF 334..>473 CDD:279011 14/53 (26%)
plc-1NP_001360638.1 Ank_2 193..328 CDD:372319
ANK repeat 193..219 CDD:293786
ANK repeat 221..293 CDD:293786
ANK repeat 295..328 CDD:293786
B41 <1421..1598 CDD:214604
RasGEF 1748..2019 CDD:214539 9/66 (14%)
EFh_PI-PLCepsilon 2401..2581 CDD:320033
EF-hand motif 2402..2429 CDD:320033
EF-hand motif 2435..2500 CDD:320033
EF-hand motif 2509..2544 CDD:320033
PLN02952 2526..3215 CDD:178538
EF-hand motif 2549..2581 CDD:320033
PI-PLCc_epsilon 2595..3059 CDD:176538
Ubiquitin_like_fold 3255..3349 CDD:391949
RA2_PLC-epsilon 3421..3524 CDD:340478
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.