DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and AgaP_AGAP004853

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_314338.4 Gene:AgaP_AGAP004853 / 1275114 VectorBaseID:AGAP004853 Length:674 Species:Anopheles gambiae


Alignment Length:282 Identity:58/282 - (20%)
Similarity:101/282 - (35%) Gaps:63/282 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 RPHELLGRLLDSVPESECLESLVSLLAEWTMKFPYDYRDERMMSHVKHIVARCSNSHLEAAVSQT 292
            :|::...:.||.        |:.:.|.|...:.|..:||.:  ...||:..:.:...:|:     
Mosquito    61 QPNQHAEKALDG--------SIDTPLIEDGKRKPERHRDRQ--PDDKHLCHKATAGSIES----- 110

  Fly   293 LSALLKRLTDLERHEADLRACQTNDKSGPETPLNCPTATQYAQIV--CR-------------VEK 342
                   |.|.....:..|...:..|.....|.| .|.:....||  |:             ::.
Mosquito   111 -------LNDGCSATSSFRPWHSYSKKSYSLPPN-TTISDVGSIVFSCQQVSPAELAAQITLLDF 167

  Fly   343 KLAKHIGGEEFLQCSSMILLDKQKKWDQPSTSGAPPGAQDPKKTCNLETYLDWSARLRLFVCNEI 407
            .:...|..||...|.          |.:.:.....|......|..|..|:  |:.:       ||
Mosquito   168 PIFNAIQPEELTSCG----------WTKKNKHTLAPNVVAFTKRFNHTTF--WTVQ-------EI 213

  Fly   408 LQSVGIEGRSRTVELWSGVAQYCLLVGNYNSATAILESLESPAIARLKITWSKLQVT---CQQLD 469
            |..|..:.|:..:..:..||:....:.|.:|..|::.:|:|.::.|||.:|  |.|:   .||||
Mosquito   214 LNGVSPKDRAEIISHFIKVAKKLHDINNLHSLFAVISALKSASVHRLKESW--LLVSRKDQQQLD 276

  Fly   470 CMQRHAEGHGHLWQKQAISLNE 491
            .:. |.......|......||:
Mosquito   277 RLS-HLFDESDNWSSLRKCLNQ 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 12/71 (17%)
RasGEF 334..>473 CDD:279011 35/156 (22%)
AgaP_AGAP004853XP_314338.4 RasGEF 152..389 CDD:214539 36/168 (21%)
PH_RalGPS1_2 547..660 CDD:270120
PH 549..655 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.