Sequence 1: | NP_001285578.1 | Gene: | CG34393 / 33534 | FlyBaseID: | FBgn0085422 | Length: | 691 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_308514.4 | Gene: | AgaP_AGAP007307 / 1269861 | VectorBaseID: | AGAP007307 | Length: | 998 | Species: | Anopheles gambiae |
Alignment Length: | 401 | Identity: | 73/401 - (18%) |
---|---|---|---|
Similarity: | 132/401 - (32%) | Gaps: | 139/401 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 191 IVSGP----LDSLIETLL-----PKDVVDLDKEFVFSFLLSCRLFLRPHELLGRL---------L 237
Fly 238 DSVPESE--------CLESLVSLLAEWTMKFPYDYRDERMMSHVKHIVARCSNSHLEAAVSQTLS 294
Fly 295 ALLKRLTDLERHEAD--LRACQ-----------------TNDKS--GPE--------------TP 324
Fly 325 LNCPTATQYAQIV--CRVEK-------------------------------KLAKHIGGEEFLQC 356
Fly 357 SSMI-----LLDKQKKWDQPSTSGAPPGAQD-------------------------------PKK 385
Fly 386 TCNLETYLDWSARLRLFVCNEILQSVGIEGRSRTVELWSGVAQYCLLVGNYNSATAILESLESPA 450
Fly 451 IARLKITWSKL 461 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34393 | NP_001285578.1 | REM | 196..300 | CDD:100121 | 25/125 (20%) |
RasGEF | 334..>473 | CDD:279011 | 32/197 (16%) | ||
AgaP_AGAP007307 | XP_308514.4 | Crp | 16..>134 | CDD:223736 | |
CAP_ED | 24..138 | CDD:237999 | |||
DEP_Epac | 194..323 | CDD:239884 | |||
CAP_ED | 345..456 | CDD:237999 | |||
Crp | 354..>447 | CDD:223736 | |||
RasGEF_N | 481..588 | CDD:279012 | 24/113 (21%) | ||
RasGEF | 756..996 | CDD:214539 | 24/118 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |