DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and zbtb22

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_002938727.2 Gene:zbtb22 / 100488727 XenbaseID:XB-GENE-6458515 Length:436 Species:Xenopus tropicalis


Alignment Length:228 Identity:48/228 - (21%)
Similarity:72/228 - (31%) Gaps:85/228 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 RPHELLGRLLDS-------------VPESECLE------SLVSLLAEWTMKFPYDYRDERMMSHV 273
            |||.  ||..::             .|...|:|      .:||..||..:..|.....|..    
 Frog   148 RPHS--GRASENQSPSSSNYFSPREAPSEPCVERGRRRSEVVSDGAEEAVGEPEQGGGEAS---- 206

  Fly   274 KHIVARCSNSHLEAAVSQTLSALLKRLTDLER-HEADLRACQTNDKSGPE--------------- 322
               ||.||:....:.|.|.....:|:    || |:..|..|:..::...|               
 Frog   207 ---VASCSSYRRPSIVPQRHWVYVKK----ERPHQGLLLTCEGEEEEDDELEEDEEEEQLSISDV 264

  Fly   323 TPLNCPTATQYAQI-VCRVEKKL--AKHIGGEEFLQCSSMILLDKQKKWDQ----PS-------- 372
            ..||.|.    .|: .|.....:  .:..||..:.|...::.||.|  .:|    ||        
 Frog   265 RTLNAPE----EQVNFCEPSDGMPYEEGAGGSGYPQGPPLLPLDMQ--GNQLLVLPSGHGAAGQG 323

  Fly   373 TSGAPPGAQDPKKTCNLETYLDWSARLRLFVCN 405
            .||..||.:..|                :|:|:
 Frog   324 GSGTSPGGEGGK----------------IFLCH 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 21/90 (23%)
RasGEF 334..>473 CDD:279011 18/87 (21%)
zbtb22XP_002938727.2 BTB_POZ_ZBTB22_BING1 12..123 CDD:349519
C2H2 Zn finger 339..358 CDD:275368 1/2 (50%)
zf-H2C2_2 352..374 CDD:372612
zf-C2H2 364..386 CDD:333835
C2H2 Zn finger 366..386 CDD:275368
zf-H2C2_2 378..401 CDD:372612
C2H2 Zn finger 394..418 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.