DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and rapgefl1

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_001921020.3 Gene:rapgefl1 / 100149497 ZFINID:ZDB-GENE-131121-404 Length:621 Species:Danio rerio


Alignment Length:275 Identity:57/275 - (20%)
Similarity:110/275 - (40%) Gaps:53/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 CRLFLRPHE---LLGRLLDSVPESECLESLVSLLAEWTMKFPYDYRDERMMSHVKHIVARCSNSH 284
            ||::...|.   :..||...|.|      :::|:.|     ...|.:::.......|:...::|.
Zfish   277 CRVYTPDHSYVTIRSRLSCRVGE------ILALVKE-----KLQYSEDQPTQPANLILVAVTSSG 330

  Fly   285 LEAAVSQTLSALLKRLTDLERHEADLRACQTNDKSG----PE----TP----LNCPTATQYAQIV 337
            .:|....:..|:...| .:..|   |.||:..:...    ||    ||    |:..:|.:.|..:
Zfish   331 EKAVFRPSDEAVFTTL-GVNTH---LFACEPAELESLIPLPEEIHWTPGDSKLHDMSAEEVANQL 391

  Fly   338 CRVEKKLAKHIGGEEFLQCSSMILLDKQKKWDQPSTSGAPPGAQDPKKTCNLETYLDWSARLRLF 402
            ...:.:|...:...||: |  .:...:|.:|                :..|||..|...:.::.:
Zfish   392 VVFDWELFSCVHEVEFV-C--YVFHGEQARW----------------RPLNLELILQRCSEVQHW 437

  Fly   403 VCNEILQSVGIEGRSRTVELWSGVAQYCLLVGNYNSATAILESLESPAIARLKITW----SKLQV 463
            |..||||...:..|.:.:..:..:|..|....:..|..|::..|::||::||::||    .|.:.
Zfish   438 VATEILQCQSLPKRIQLLRKFIKIAALCKQQQDLLSFLALVLGLDNPAVSRLRLTWEGLPGKFRK 502

  Fly   464 TCQQLDCMQRHAEGH 478
            ..||.:.:...:..|
Zfish   503 QFQQFESIADPSRNH 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 14/79 (18%)
RasGEF 334..>473 CDD:279011 31/142 (22%)
rapgefl1XP_001921020.3 RasGEF 379..619 CDD:214539 34/158 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.