DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and rasgrp1

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001093748.2 Gene:rasgrp1 / 100101791 XenbaseID:XB-GENE-489811 Length:811 Species:Xenopus tropicalis


Alignment Length:331 Identity:70/331 - (21%)
Similarity:120/331 - (36%) Gaps:78/331 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 IMYINGRIVSG-PLDSLIETLLPKDVVDLDKEF-----VFSFLLSCRLFLRPH-ELLGRL----- 236
            :|...|::..| .||.||:..:  ...|||...     :...:|:...||.|. |||.:|     
 Frog    65 VMMPLGKLSKGASLDDLIQMCI--QAFDLDGNMGQNSELLQIMLTMHGFLLPSTELLMKLRTLYQ 127

  Fly   237 --LDSVPESECLESLVSLLAEWT----MKFPYDYRDERMMSHVKHIVARCSNSHLEAAVSQTLSA 295
              |.:...|.||. :...:..|.    :.|..|.:..:.|...:.:| |.....|.         
 Frog   128 DALQNRSFSFCLR-ICYFIRYWVTELWVMFKMDAKLTQAMEEFQELV-RSKGEELH--------- 181

  Fly   296 LLKRLTDLERHEADLRACQTNDKSGPETPLNCPTATQYAQIVCRVE-KKLAKHIGGEEFLQCSSM 359
              .||.|    .|.:.:...:.|.......||....:.:.:...:| ::||:|:...||.....:
 Frog   182 --WRLID----TAQINSRDWSRKLTQRIKPNCSKKRKVSLLFDHLEPQELAEHLTYLEFKAFRRI 240

  Fly   360 ILLDKQKKWDQPSTSGAPPGAQDPKKTCNLETYLDWSARLRLFVCNEILQSVGI--------EGR 416
            ...|.|..    ..||.      .|:...:|.        .:.:||.|.|.|.:        :.|
 Frog   241 SFSDYQNY----IVSGC------VKENPTMER--------SIALCNGISQWVQLMVLSRPTPQLR 287

  Fly   417 SRTVELWSGVAQYCLLVGNYNSATAILESLESPAIARLKIT--------------WSKLQVTCQQ 467
            :..:..:..|||....:.|:|:..|::..|...:|:|||.|              .::|..:|:.
 Frog   288 AEVLTKFIHVAQKLHQLQNFNTLMAVIGGLCHSSISRLKDTSAHVSHDVNKVLNEMTELLSSCRN 352

  Fly   468 LDCMQR 473
            .|..:|
 Frog   353 YDNYRR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 26/120 (22%)
RasGEF 334..>473 CDD:279011 33/161 (20%)
rasgrp1NP_001093748.2 REM 77..193 CDD:100121 30/134 (22%)
RasGEF 217..453 CDD:214539 34/160 (21%)
EF-hand_7 494..543 CDD:372618
C1_1 558..607 CDD:365894
BRLZ 744..799 CDD:197664
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.