DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15403 and NAT2

DIOPT Version :9

Sequence 1:NP_608749.2 Gene:CG15403 / 33527 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_011663.3 Gene:NAT2 / 853050 SGDID:S000003379 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:44/226 - (19%)
Similarity:85/226 - (37%) Gaps:62/226 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SPVHLFHSTALMQNYIS-GTRKPISIREKREYKYSSQDM--------NWTKHGGCFKQNYSTESA 84
            |||  |....|...::: ..:|.:|...:|::....:.|        ..:.|....::.||||..
Yeast     9 SPV--FKRIFLRWGFVTLPIQKTVSHTLRRDFSAPCRSMVKCLLLRPGISVHSAQDRKFYSTEEK 71

  Fly    85 ST------GTATTLKITKREQLKRAFKEYGATIVVFHVVISVISLG-GFYALVSSGINLVPVL-- 140
            |:      ..:...|..:...:|....:||.:.::.:::::.:.|. .|..:.|.|...:.:.  
Yeast    72 SSQFDENKSKSNNGKKNEPHGIKGLMAKYGYSALIVYILLTCVDLPLCFLGVHSLGEEKIKIYLN 136

  Fly   141 ---EYFGMGS-----------------SAV----AEKV--AAGSTF----------------VVA 163
               :..|||.                 .||    |:||  |:..||                ::|
Yeast   137 RGKQLIGMGEPDESKVIQDVRRKQAHREAVQAENADKVEDASRKTFNERWQEMKDSTLLAELLIA 201

  Fly   164 FAVHKIFAPARISITLGTTPFIVRYLRSKGL 194
            :.:||.....|:.:|...||..|:.|:..|:
Yeast   202 YGIHKSLIIVRVPLTAVLTPSFVKLLQRFGI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 24/130 (18%)
NAT2NP_011663.3 DUF1279 93..221 CDD:369134 23/127 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344825
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4526
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.