DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15403 and NAT2

Sequence 1:NP_608749.2 Gene:CG15403 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_011663.3 Gene:NAT2 SGDID:S000003379 Length:288 Species:Saccharomyces cerevisiae

Alignment Length:226 Identity:44/227 (19%)
Similarity:85/227 (37%) Gaps:62/227 (27%)


  Fly    29 SPVHLFHSTALMQNYIS-GTRKPISIREKREYKYSSQDM--------NWTKHGGCFKQNYSTESA 84
            |||  |....|...::: ..:|.:|...:|::....:.|        ..:.|....::.||||..
Yeast     9 SPV--FKRIFLRWGFVTLPIQKTVSHTLRRDFSAPCRSMVKCLLLRPGISVHSAQDRKFYSTEEK 71

  Fly    85 ST------GTATTLKITKREQLKRAFKEYGATIVVFHVVISVISLG-GFYALVSSGINLVPVL-- 140
            |:      ..:...|..:...:|....:||.:.::.:::::.:.|. .|..:.|.|...:.:.  
Yeast    72 SSQFDENKSKSNNGKKNEPHGIKGLMAKYGYSALIVYILLTCVDLPLCFLGVHSLGEEKIKIYLN 136

  Fly   141 ---EYFGMGS-----------------SAV----AEKV--AAGSTF----------------VVA 163
               :..|||.                 .||    |:||  |:..||                ::|
Yeast   137 RGKQLIGMGEPDESKVIQDVRRKQAHREAVQAENADKVEDASRKTFNERWQEMKDSTLLAELLIA 201

  Fly   164 FAVHKIFAPARISITLGTTPFIVRYLRSKGL 194
            :.:||.....|:.:|...||..|:.|:..|:
Yeast   202 YGIHKSLIIVRVPLTAVLTPSFVKLLQRFGI 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 25/131 (19%)
NAT2NP_011663.3 DUF1279 92..221 CDD:284361 24/129 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195107057
eggNOG 1 0.900 E1_KOG4526
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.