DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15403 and Fam210b

Sequence 1:NP_608749.2 Gene:CG15403 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_080188.3 Gene:Fam210b MGIID:1914267 Length:190 Species:Mus musculus

Alignment Length:136 Identity:68/137 (50%)
Similarity:91/137 (66%) Gaps:4/137 (3%)


  Fly    69 TKHGGCFKQ---NYSTESASTGTATTLKITKREQLKRAFKEYGATIVVFHVVISVISLGGFYALV 130
            |..|.|..:   |.:.|...:.|.|..|:::.:|||:.|:||||..|..|:.||::|||.||.:|
Mouse    53 TARGDCLSRQEPNRTPEPGGSVTGTEKKLSRTQQLKKVFQEYGAVGVSMHIGISLVSLGIFYTVV 117

  Fly   131 SSGINLVPVLEYFGMGSSAVAEKVAAG-STFVVAFAVHKIFAPARISITLGTTPFIVRYLRSKGL 194
            ||||::..:|...|...|.|..|:||| ||||||:|:||:|||.||||||.:.||:|||.||.||
Mouse   118 SSGIDMSAILLKLGFKESLVQSKMAAGTSTFVVAYAIHKLFAPVRISITLVSVPFVVRYFRSVGL 182

  Fly   195 LKPKST 200
            .||.:|
Mouse   183 FKPPAT 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 49/87 (56%)
Fam210bNP_080188.3 DUF1279 85..172 CDD:284361 49/87 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195093970
eggNOG 1 0.900 E1_KOG4526
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4633
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006355
OrthoInspector 1 1.000 T615226
orthoMCL 1 0.900 OOG5_131692
Panther 1 1.100 LDO PTHR21377
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4368
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.