DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15403 and fam210b

Sequence 1:NP_608749.2 Gene:CG15403 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001028923.1 Gene:fam210b ZFINID:ZDB-GENE-050913-122 Length:223 Species:Danio rerio

Alignment Length:164 Identity:63/165 (38%)
Similarity:100/165 (61%) Gaps:16/165 (10%)


  Fly    38 ALMQNYISGTRKPISIREKREYKYSSQDMNWTKHGGCFKQNYSTESASTGTATTLKITKREQLKR 102
            ::..:::...|:.::..||.|   .:.|:          ::....||:.|  :.||.:|.:||::
Zfish    73 SVRSSFVMQPRRSLTTPEKHE---RAADI----------RSDGVSSAADG--SELKASKVQQLRQ 122

  Fly   103 AFKEYGATIVVFHVVISVISLGGFYALVSSGINLVPVLEYFGMGSSAVAEKVAAG-STFVVAFAV 166
            .|::|||..|.||:.||:||||.||..||||:::..:|...|...:.|..::||| |.||:|:||
Zfish   123 VFQQYGAVGVSFHICISLISLGIFYLAVSSGLDVASLLCKLGFSEAVVQSRLAAGTSVFVLAYAV 187

  Fly   167 HKIFAPARISITLGTTPFIVRYLRSKGLLKPKST 200
            ||:|||.||||||...|.|||:||..||.:.:::
Zfish   188 HKLFAPLRISITLVCVPLIVRHLRRTGLFRSRTS 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 45/87 (52%)
fam210bNP_001028923.1 DUF1279 118..205 CDD:284361 45/87 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195093743
eggNOG 1 0.900 E1_KOG4526
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006355
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131692
Panther 1 1.100 LDO PTHR21377
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.