DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15403 and fam210aa

Sequence 1:NP_608749.2 Gene:CG15403 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001038459.1 Gene:fam210aa ZFINID:ZDB-GENE-030131-5627 Length:242 Species:Danio rerio

Alignment Length:178 Identity:50/179 (28%)
Similarity:78/179 (44%) Gaps:19/179 (11%)


  Fly    25 LKTMSPVHLFHSTALMQNYISGTRKPISIREKREYKYSSQDMNWTKHGGCFKQNYSTESASTGTA 89
            |..:|||...|           ||:.......|..|.......|...........|.:::::|..
Zfish    16 LLQISPVSHCH-----------TRRMQDSPSHRSLKQLISSQRWLNSTTALCSPTSQKTSASGQE 69

  Fly    90 TTLKITKR-----EQLKRAFKEYGATIVVFHVVISVISLGGFYALVSSGINLVPVLEYFGMGSSA 149
            ....:..:     ::.|:.||:||..::..|::.|.:..|.||.....|:||||.|||.|.....
Zfish    70 EPDPLHDKSSGLIQRFKKTFKQYGKVMIPVHLLTSTMWFGTFYYAAMKGVNLVPFLEYVGFPDKV 134

  Fly   150 V--AEKVAAGSTFVVAFAVHKIFAPARISITLGTTPFIVRYLRSKGLL 195
            |  .|...:|.. :.|:|::||..|||.::|||.|...|:|||..|.:
Zfish   135 VKLLENSQSGYA-LTAYAMYKIATPARYTVTLGGTSLSVKYLRKHGYM 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 33/88 (38%)
fam210aaNP_001038459.1 DUF1279 83..170 CDD:284361 33/88 (38%)
Apolipoprotein <187..236 CDD:279749
LEA_4 188..231 CDD:111833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4368
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.