DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15403 and CG17508

Sequence 1:NP_608749.2 Gene:CG15403 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_652101.2 Gene:CG17508 FlyBaseID:FBgn0039970 Length:321 Species:Drosophila melanogaster

Alignment Length:175 Identity:95/176 (54%)
Similarity:118/176 (67%) Gaps:31/176 (18%)


  Fly    57 REYKYSSQDMNWTKHGG----------CFKQN---------------YSTES----ASTGTATTL 92
            :|:|:::|:|..:.:.|          .:.||               |||:|    :||.|.|..
  Fly   147 QEFKFTAQNMQCSHYSGLRESLRADWATYDQNATLKTNDQGLFNRRYYSTQSPMQNSSTKTPTGA 211

  Fly    93 KITKREQLKRAFKEYGATIVVFHVVISVISLGGFYALVSSGINLVPVLEYFGMGSSAVAEKVAAG 157
            |::|.||||||||||||.||.|||.||:|||.|||.||||||||||.||..|:.|.|:.||||.|
  Fly   212 KLSKSEQLKRAFKEYGAPIVAFHVGISLISLAGFYVLVSSGINLVPALECIGIASPAIVEKVATG 276

  Fly   158 STFVVAFAVHKIFAPARISITLGTTPFIVRYLRSK--GLLKPKST 200
            ||||||:||||:|||||||||||:.||:|||:|||  .:.|||:|
  Fly   277 STFVVAYAVHKVFAPARISITLGSVPFVVRYIRSKKSQIPKPKNT 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 67/86 (78%)
CG17508NP_652101.2 ALDH-SF <113..160 CDD:299846 4/13 (31%)
DUF1279 217..303 CDD:284361 67/86 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C194763827
eggNOG 1 0.900 E1_KOG4526
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006355
orthoMCL 1 0.900 OOG5_131692
Panther 1 1.100 P PTHR21377
RoundUp 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.