DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15403 and Fam210b

Sequence 1:NP_608749.2 Gene:CG15403 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001100017.1 Gene:Fam210b RGDID:1311378 Length:190 Species:Rattus norvegicus

Alignment Length:133 Identity:70/134 (52%)
Similarity:91/134 (68%) Gaps:4/134 (3%)


  Fly    69 TKHGGCFK---QNYSTESASTGTATTLKITKREQLKRAFKEYGATIVVFHVVISVISLGGFYALV 130
            |..|.|.:   .|.:|:..|..|:|..|::|.:|||:.|:||||..|..|:.||::|||.||.:|
  Rat    53 TARGDCLRLQAPNRTTDPGSGATSTEKKLSKSQQLKKVFQEYGAVGVSLHIGISLVSLGIFYTIV 117

  Fly   131 SSGINLVPVLEYFGMGSSAVAEKVAAG-STFVVAFAVHKIFAPARISITLGTTPFIVRYLRSKGL 194
            ||||::..:|...|...|.|..|:||| ||||||:||||:|||.||||||.:.||:|||.||.||
  Rat   118 SSGIDMSAILLKLGFKESLVQSKMAAGTSTFVVAYAVHKLFAPVRISITLVSVPFLVRYFRSVGL 182

  Fly   195 LKP 197
            .||
  Rat   183 FKP 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 50/87 (57%)
Fam210bNP_001100017.1 DUF1279 85..172 CDD:284361 50/87 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195088831
eggNOG 1 0.900 E1_KOG4526
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4487
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1506373at2759
OrthoFinder 1 1.000 FOG0006355
OrthoInspector 1 1.000 T617330
orthoMCL 1 0.900 OOG5_131692
Panther 1 1.100 LDO PTHR21377
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.