DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15403 and FAM210B

Sequence 1:NP_608749.2 Gene:CG15403 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_543011.2 Gene:FAM210B HGNCID:16102 Length:192 Species:Homo sapiens

Alignment Length:137 Identity:65/138 (47%)
Similarity:85/138 (62%) Gaps:10/138 (7%)


  Fly    69 TKHGGCFKQNYSTESASTGTATT-------LKITKREQLKRAFKEYGATIVVFHVVISVISLGGF 126
            |..|.|  :.:...|.:|||..:       .|.:|.:|||:.|:|||...|..|:.||:||||.|
Human    53 TARGDC--RGHQDPSQATGTTGSSVSCTEEKKQSKSQQLKKIFQEYGTVGVSLHIGISLISLGIF 115

  Fly   127 YALVSSGINLVPVLEYFGMGSSAVAEKVAAG-STFVVAFAVHKIFAPARISITLGTTPFIVRYLR 190
            |.:||||:::..:|...|...|.|..|:||| ||||||:|:||:|||.||||||.:.|.||||.|
Human   116 YMVVSSGVDMPAILLKLGFKESLVQSKMAAGTSTFVVAYAIHKLFAPVRISITLVSVPLIVRYFR 180

  Fly   191 SKGLLKP 197
            ..|..||
Human   181 KVGFFKP 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 48/87 (55%)
FAM210BNP_543011.2 DUF1279 87..174 CDD:284361 48/87 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195092255
eggNOG 1 0.900 E1_KOG4526
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4772
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006355
OrthoInspector 1 1.000 T608393
orthoMCL 1 0.900 OOG5_131692
Panther 1 1.100 LDO PTHR21377
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4368
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.