DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15403 and FAM210B

DIOPT Version :9

Sequence 1:NP_608749.2 Gene:CG15403 / 33527 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_543011.2 Gene:FAM210B / 116151 HGNCID:16102 Length:192 Species:Homo sapiens


Alignment Length:137 Identity:65/137 - (47%)
Similarity:85/137 - (62%) Gaps:10/137 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 TKHGGCFKQNYSTESASTGTATT-------LKITKREQLKRAFKEYGATIVVFHVVISVISLGGF 126
            |..|.|  :.:...|.:|||..:       .|.:|.:|||:.|:|||...|..|:.||:||||.|
Human    53 TARGDC--RGHQDPSQATGTTGSSVSCTEEKKQSKSQQLKKIFQEYGTVGVSLHIGISLISLGIF 115

  Fly   127 YALVSSGINLVPVLEYFGMGSSAVAEKVAAG-STFVVAFAVHKIFAPARISITLGTTPFIVRYLR 190
            |.:||||:::..:|...|...|.|..|:||| ||||||:|:||:|||.||||||.:.|.||||.|
Human   116 YMVVSSGVDMPAILLKLGFKESLVQSKMAAGTSTFVVAYAIHKLFAPVRISITLVSVPLIVRYFR 180

  Fly   191 SKGLLKP 197
            ..|..||
Human   181 KVGFFKP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 47/86 (55%)
FAM210BNP_543011.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..80 5/24 (21%)
DUF1279 87..174 CDD:284361 47/86 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152555
Domainoid 1 1.000 93 1.000 Domainoid score I7556
eggNOG 1 0.900 - - E1_KOG4526
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4857
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1506373at2759
OrthoFinder 1 1.000 - - FOG0004761
OrthoInspector 1 1.000 - - otm40952
orthoMCL 1 0.900 - - OOG6_103781
Panther 1 1.100 - - LDO PTHR21377
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4368
SonicParanoid 1 1.000 - - X4449
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.