DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and ZTA1

DIOPT Version :8

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_009602.1 Gene:ZTA1 / 852335 SGDID:S000000250 Length:334 Species:Saccharomyces cerevisiae

Alignment Length:380 Identity:83/380 - (21%)
Similarity:151/380 - (39%) Gaps:84/380 - (22%)


  Fly    50 DKMRGWQLHNYGDIDELQLSEMLKIPQIRCSNECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQ 114
            |::.|:.:..|.|.....:||          .|.|::.:.|.||.|:....:|.       ..| 
Yeast    15 DEIGGYDVIKYEDYPVPSISE----------EELLIKNKYTGVNYIESYFRKGI-------YPC- 61

  Fly   115 PGDGIEFPLILGREFCGELVQTGMGV-SLPLGSRVWGVVPLQATIGSHAEYVAVPSYCLAPA--- 175
                 |.|.:||||..|.:|..|.|| :..:|.:|     ...:..:.|:|..:.|.  .|.   
Yeast    62 -----EKPYVLGREASGTVVAKGKGVTNFEVGDQV-----AYISNSTFAQYSKISSQ--GPVMKL 114

  Fly   176 PKELDDYEAASVLYAGLTAWSGLYITGGLGGPCGATTASGGGAHKR----VLVLGGSGGVGTLAI 236
            ||...|.|..  |||           .||.....|.:.:....|.:    ||:...:||||.:..
Yeast   115 PKGTSDEELK--LYA-----------AGLLQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGLILN 166

  Fly   237 QILKSQKVQVLATCS-ENAIEMVRNLGADLVVDYNNPQAMEELCKYAPYDIVLDCAGQGGQKAAE 300
            |:||.:....:|..| :..:::.:..||:.:::.:....:.::.|:.            ..|..:
Yeast   167 QLLKMKGAHTIAVASTDEKLKIAKEYGAEYLINASKEDILRQVLKFT------------NGKGVD 219

  Fly   301 SKYDFRQYITFSSPLLANIDKQGLGV-----GALKNVFDLFQTNVRSVT----QRGGLV----KW 352
            :.:|.....||...|.| :.::|:.|     ..|...|.:.:.:.:::|    |..|.:    :|
Yeast   220 ASFDSVGKDTFEISLAA-LKRKGVFVSFGNASGLIPPFSITRLSPKNITLVRPQLYGYIADPEEW 283

  Fly   353 GFFSPAPQGIQFLQKLVEQRKLMPLIDSSYGFSELPKAFEKMKSGHLRGKIVVKL 407
            .::|....|      ||..:||...|..:|...:...|...::|....||:|:::
Yeast   284 KYYSDEFFG------LVNSKKLNIKIYKTYPLRDYRTAAADIESRKTVGKLVLEI 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 82/375 (22%)
Qor 52..406 CDD:223677 82/375 (22%)
ZTA1NP_009602.1 QOR2 10..332 CDD:176189 83/378 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3553
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.