DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and CG4836

DIOPT Version :8

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001138085.1 Gene:CG4836 / 42387 FlyBaseID:FBgn0270925 Length:1224 Species:Drosophila melanogaster

Alignment Length:372 Identity:82/372 - (22%)
Similarity:138/372 - (37%) Gaps:101/372 - (27%)


  Fly    82 ECLVRIRATAVNPIDL-----------AMLRGYGAT-VLNKM-RC----QPGDGIEFPLILGREF 129
            :.|:|..:.||:..|:           ||..|:.|| ::.:: ||    ..||.:.....|....
  Fly   908 DVLIRTGSVAVSNSDIHVYENGNRDMEAMSLGHDATGIVEELGRCVQHLHVGDRVVMESALSCGI 972

  Fly   130 CGELVQTGMGVSLPLGSRVWGVVPLQATIGSHAEYVAVPSYCLAPAPKELDDYEAASVLYAGLTA 194
            | :|.:.|      |.:...|:|    ..|..:.|...|:......|      |:.|:....||.
  Fly   973 C-DLCKKG------LYNMCSGLV----YNGFLSTYQTHPADLCHRLP------ESISMEAGALTQ 1020

  Fly   195 WSGLYITGGLGGPCGATTASGGGAHKRVLVLGG-----SGGVGTLAIQILKSQKVQVLATCSENA 254
                  |..||  |.|...:.......||:||.     :.|:...||    ..|...:|.|...|
  Fly  1021 ------TLALG--CQACFKANVTPTSNVLILGACPTAVAAGICAKAI----GAKRVAIAGCMAPA 1073

  Fly   255 IEMV-RNLGADLVVDYNNPQAMEELCK--YAPY----DIVLDCAGQGGQKAAESKYDFRQYITFS 312
            :::| |:.|.. .|::::.....|:.:  |:.:    |.|::|:                 |:..
  Fly  1074 LDVVARDFGFQ-AVEFDSNALFGEVLEAIYSKFRDWPDCVINCS-----------------ISAM 1120

  Fly   313 SPLLANIDKQGLGVGALK---------NVFDLFQTNVRSVTQRGGLVKWGFFSPA---PQGIQFL 365
            :..||.:..|..||..|.         |..|:...|:|.|..         |..|   |..:|.:
  Fly  1121 TMNLAVMALQPCGVCVLAECDSECASFNALDVLMKNIRLVPS---------FRSANMYPTALQLM 1176

  Fly   366 QKLVEQRKLMPLIDSSYGFSELPKAFE--KMKSGHLRGKIVVKLREE 410
            |.  .:..:...|.::|..|:..:||.  :.:|....||::|...||
  Fly  1177 QS--GRAHMQKFITATYPLSKADEAFRAAQHESNIGLGKVIVNCAEE 1221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 79/366 (22%)
Qor 52..406 CDD:223677 79/366 (22%)
CG4836NP_001138085.1 MDR 888..1218 CDD:302572 80/367 (22%)
Tdh 893..1217 CDD:223991 79/366 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115614646
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.