DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and Rtn4ip1

DIOPT Version :8

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001101114.1 Gene:Rtn4ip1 / 309912 RGDID:1563384 Length:396 Species:Rattus norvegicus

Alignment Length:389 Identity:142/389 - (36%)
Similarity:207/389 - (53%) Gaps:41/389 - (10%)


  Fly    41 TPPP------TSKSADKMRGWQLHNYGDIDELQLSEMLKIPQIRCSNECLVRIRATAVNPIDLAM 99
            |.||      ||..:..|..|.:..||..:.|:.::.:.:|.|...||.::::.|.:|||||:.|
  Rat    26 TRPPYRGISTTSARSTVMPAWVIDKYGKNEVLRFTQNMMLPIIHYPNEVIIKVHAASVNPIDVNM 90

  Fly   100 LRGYGATVLNKMRCQP----GDGIEFPLILGREFCGELVQTGMGVS-LPLGSRVWGVVP--LQAT 157
            ..|||||.|| |:..|    ..|.||||.|||:..|.:::.|:.|. ...|..||..||  .|.|
  Rat    91 RSGYGATALN-MKRDPLHMKTKGEEFPLTLGRDVSGVVMECGLDVRYFQPGDEVWAAVPPWKQGT 154

  Fly   158 IGSHAEYVAVPSYCLAPAPKELDDYEAASVLYAGLTAWSGLYITGGLGGPCGATTASGGGAHKRV 222
            :   :|:|.|....::..||.|...:|||:.|..|||||.:...|||    .|....|    ||.
  Rat   155 L---SEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGGL----NAKNCMG----KRA 208

  Fly   223 LVLGGSGGVGTLAIQILKSQKVQVLATCSENAIEMVRNLGADLVVDYNNPQAMEELCKYAPYDIV 287
            |:||.||||||.|||::|:....|.|.||::|.|:||.||||.|:||......|:|.....:|.:
  Rat   209 LILGASGGVGTFAIQVMKAWGAHVTAVCSKDASELVRKLGADEVIDYTMGSVEEQLKSLKLFDFI 273

  Fly   288 LDCAGQGGQKAAES---KYDFRQYITFSSPLLANIDKQGLGVGALKNVFDLFQTNVRSVTQ---- 345
            ||..|...:..|.:   |:....|:|..:|.|.|:|:.|:..|.|       ||.|...|:    
  Rat   274 LDNVGGSTETWALNFLKKWSGATYVTLVTPFLLNMDRLGIADGML-------QTGVTVGTKALKH 331

  Fly   346 --RGGLVKWGFFSPAPQGIQFLQKLVEQRKLMPLIDSSYGFSELPKAFEKMKSGHLRGKIVVKL 407
              :|...:|.||..:...:..:.:||:..|:.|:|:.::.|||:|:||.|::.||.|||.||.:
  Rat   332 LWQGVHYRWAFFMASGPYLDEIAELVDGGKIRPVIERTFPFSEVPEAFLKVERGHARGKTVVNV 395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 136/369 (37%)
Qor 52..406 CDD:223677 136/369 (37%)
Rtn4ip1NP_001101114.1 Qor 43..395 CDD:223677 137/370 (37%)
RTN4I1 43..394 CDD:176210 136/369 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C298886146
eggNOG 1 0.900 E1_COG0604
Hieranoid 1 1.000
Homologene 1 1.000 H13105
Inparanoid 1 1.050 215 1.000 Inparanoid score I3486
OMA 1 1.010
OrthoDB 1 1.010 D558414at33208
OrthoFinder 1 1.000 FOG0002914
OrthoInspector 1 1.000 T1086890
orthoMCL 1 0.900 OOG5_127317
Panther 1 1.100 LDO PTHR11695
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.