DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and Tp53i3

DIOPT Version :8

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_008767839.1 Gene:Tp53i3 / 289138 RGDID:1304982 Length:378 Species:Rattus norvegicus

Alignment Length:435 Identity:86/435 - (19%)
Similarity:135/435 - (31%) Gaps:134/435 - (30%)


  Fly    10 LCLRQLVRLNRRQYSAPAKSVLSGSQTNDQATPPPTSKSADKMRGWQLHNYGDIDELQLSEMLKI 74
            ||.||..:...|.|.|...:.|....|..:..|.|..                            
  Rat    42 LCCRQAGQGQSRHYRAAVCTELKQPLTIQEVAPRPIG---------------------------- 78

  Fly    75 PQIRCSNECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQPGDGIEFPLILGREFCGELVQTGMG 139
            ||     |..|.:....:|..|..:.||           |..:....|...|.||.|.:::.|..
  Rat    79 PQ-----EVRVDVHFCGINFADNLVCRG-----------QYQEKPPLPFTPGMEFSGVVLEAGAD 127

  Fly   140 VS-LPLGSRVWGVVPLQATIGSHAEYVAVPSYCLAPAPKELDDYEAASVLYAGLTAWSGLYITGG 203
            || :..|.||.||    :...|.||........|...|:.:...:||.:..:        |.|..
  Rat   128 VSTVKKGDRVIGV----SNFHSMAEQCITDQKTLWRIPENVSLQDAAVLPVS--------YGTAI 180

  Fly   204 LGGPCGATTASGGGAHKRVLVLGGSGGVGTLAIQILKS---QKVQVLATCSENAIEMVRNLGADL 265
            |.....|....|    :.|||...:|..|...|.:..:   .|| :.|..|:...::....||..
  Rat   181 LAVDHRARIQPG----ETVLVTAAAGATGLAVIDVATNVFCAKV-IAAAGSDEKCKLAMQRGAQS 240

  Fly   266 VVDYNNPQAMEELCKYAPYDIVLDCAGQGGQKAAESKYDFRQYITFSSPLLANIDKQGLGVGALK 330
            .|:|:                      ||..|.|..|      :..||.:...||..|       
  Rat   241 GVNYS----------------------QGSLKDAVKK------LVGSSGVNVAIDMVG------- 270

  Fly   331 NVFDLFQTNVRSVTQRGGLVKWGF----FSPAPQGIQFLQKL----------------------- 368
              .|:|..::||:...|.:|..||    .:..|..:..|:.:                       
  Rat   271 --GDVFLDSLRSLAWEGRIVVLGFAGGNIASVPSNLLLLKNISAMGLYWGRYQHQDFAVFSKSMS 333

  Fly   369 -----VEQRKLMPLIDSSYGFSELPKAFEKMKSGHLRGKIVVKLR 408
                 .:|..:.|...:.:...::..||..:......||:::.|:
  Rat   334 TALQYCQQGLIHPHTGAVFKLEKVNDAFLHVMQRKSTGKVLLSLK 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 74/389 (19%)
Qor 52..406 CDD:223677 74/389 (19%)
Tp53i3XP_008767839.1 QOR1 55..375 CDD:176203 80/417 (19%)
Qor 56..375 CDD:223677 79/416 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.