DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and Vat1

DIOPT Version :8

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001028855.1 Gene:Vat1 / 287721 RGDID:1308943 Length:404 Species:Rattus norvegicus

Alignment Length:407 Identity:109/407 - (26%)
Similarity:170/407 - (41%) Gaps:71/407 - (17%)


  Fly    26 PAKSVLSGSQTNDQATPPP-----TSKSADKMRGWQLHNYGDIDELQLSEMLKIPQIRCSNECLV 85
            |...|.|..|      |||     .|.||..:|...|..:|..|:::|.....:|......:..:
  Rat    34 PTVEVASDPQ------PPPAPEASASASAPPLRCLVLTGFGGYDKVKLQSRPAVPPAPGPGQVTL 92

  Fly    86 RIRATAVNPIDLAMLRG-YGATVLNKMRCQPGDGIEFPLILGREFCGELVQTGMGVS-LPLGSRV 148
            |:||..:|..||...:| |.       |..|     .|:..|.|..|.:|..|.||| ...|.| 
  Rat    93 RVRACGLNFADLMGRQGLYD-------RLPP-----LPVTPGMEGAGVVVAVGEGVSDRKAGDR- 144

  Fly   149 WGVVPLQATIGSHAEYVAVPSYCLAPAPKELDDYEAASVLYAGLTAWSGLYITGGLGGPCGATTA 213
              |:.|..: |...|.|.|||......|:.:...|||::|...:||:..|:..|.|         
  Rat   145 --VMVLNRS-GMWQEEVTVPSAQTFLMPEAMTFEEAAALLVNYITAYMVLFDFGNL--------- 197

  Fly   214 SGGGAHKRVLVLGGSGGVGTLAIQILKS-QKVQVLATCSENAIEMVRNLGADLVVDYNNPQAMEE 277
              ...|. |||...:||||..|:|:.:: :.|.|..|.|.:..|:::..|....:||:....::|
  Rat   198 --RPGHS-VLVHMAAGGVGMAALQLCRTVENVTVFGTASASKHEVLKENGVTHPIDYHTTDYVDE 259

  Fly   278 LCKYAP--YDIVLDCAGQGGQKAAESKYDFR---QYITFSSPLLANIDKQGLGVGALKNVFDLFQ 337
            :.|.:|  .|||:|  ..||...|:..:..:   :.:|:.   :||     |..|..:|:..:.:
  Rat   260 IKKISPKGVDIVMD--PLGGSDTAKGYHLLKPMGKVVTYG---MAN-----LLTGPKRNLMAMAR 314

  Fly   338 T--NVRSVTQ----RGGLVKWGFFSPAPQG--------IQFLQKLVEQRKLMPLIDSSYGFSELP 388
            |  |..|||.    :......||......|        :..|..|..|..:.|.|||.:.|.::.
  Rat   315 TWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVSRVVTHLLALYNQGHIKPRIDSVWPFEKVA 379

  Fly   389 KAFEKMKSGHLRGKIVV 405
            .|..:|:.....||:::
  Rat   380 DAMRQMQEKKNIGKVLL 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 99/376 (26%)
Qor 52..406 CDD:223677 99/376 (26%)
Vat1NP_001028855.1 MDR3 60..398 CDD:176236 99/375 (26%)
Qor 62..398 CDD:223677 98/373 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.