DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and SPBC1773.06c

DIOPT Version :8

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_595121.1 Gene:SPBC1773.06c / 2540139 PomBaseID:SPBC1773.06c Length:346 Species:Schizosaccharomyces pombe

Alignment Length:397 Identity:92/397 - (23%)
Similarity:155/397 - (39%) Gaps:113/397 - (28%)


  Fly    64 DELQLSEMLK-----IPQIRCSNECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQPGDGIEFPL 123
            ||:...:.||     :||.....|.||:::|.::|..||.:.:|.....|           :.|:
pombe     9 DEISGFDQLKPEEYEVPQKLNPGEVLVKLKAASLNYRDLIITKGLYPLPL-----------QLPV 62

  Fly   124 ILGREFCGELVQTGMGVSLPLGSRVWGVVPLQATI--------------------------GSHA 162
            :.|.:        |.|:...:|..|.|.....:.:                          |...
pombe    63 VPGSD--------GAGIIEKVGEDVEGFEKGDSVVCNFFTNYLDGTPTDFATHSALGGTRDGCFQ 119

  Fly   163 EYVAVPSYCLAPAPKELDDYEAASVLYAGLTAWSGLYITGGLGGPCGATTASGGGAHK-----RV 222
            :|..:|::.|..|||.|...|.|::..|.:|||:||:               |...|:     .|
pombe   120 KYAVLPAHALVHAPKNLSFEEIATLPCAAVTAWNGLF---------------GSKEHQVKPGNNV 169

  Fly   223 LVLGGSGGVGTLAIQILKSQKVQVLAT-CSENAIEMVRNLGADLVVDY-NNPQAMEELCKY---A 282
            ||| |:|||.|.|:|...:....|..| .|:..:|..:.|||...::| ..||......|.   .
pombe   170 LVL-GTGGVSTFALQFALAAGANVTVTSSSDEKLEFAKKLGATHTINYKKTPQWASPALKMTNGV 233

  Fly   283 PYDIVLDCAGQGGQK------AAESKYDFRQYITF-----SSPLLANIDKQGLGVGALKNVFDLF 336
            .|..|::.   ||:|      |..:|......|.|     ::|.|.:|      :|.:.|    .
pombe   234 GYHHVIEV---GGEKTLPQSIACLAKDGMISMIGFVASEGTTPNLTSI------IGQILN----R 285

  Fly   337 QTNVRSVTQRGGLVKWGFFSPAPQGIQFLQKLVEQRKLMPLIDSSYGFSELPKAFE-KMKSGHLR 400
            ..|:|           |.|..:....:.:...:|.:.:.|::|..:.|.:|.:|:| :....|: 
pombe   286 NANIR-----------GIFVGSVSMFRDMVACIEAKDIHPVVDKVFPFDQLKEAYEYQWSQAHI- 338

  Fly   401 GKIVVKL 407
            ||:|:|:
pombe   339 GKVVLKI 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 91/394 (23%)
Qor 52..406 CDD:223677 91/394 (23%)
SPBC1773.06cNP_595121.1 Qor 4..345 CDD:223677 91/395 (23%)
MDR7 12..345 CDD:176237 89/392 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002914
OrthoInspector 1 1.000 T631594
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3553
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.