DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and F39B2.3

DIOPT Version :8

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_493577.1 Gene:F39B2.3 / 173346 WormBaseID:WBGene00009554 Length:328 Species:Caenorhabditis elegans

Alignment Length:387 Identity:105/387 - (27%)
Similarity:167/387 - (43%) Gaps:87/387 - (22%)


  Fly    46 SKSADK--MRGWQLHNYG--DIDELQLSEMLKIPQIRCSNECLVRIRATAVNPIDLAMLRG-YGA 105
            |||..|  ||...:..:|  |:.|...|:|.::.:    |:.|||..|..|||:|..:..| ||.
 Worm     2 SKSICKSSMRAAVVRRFGAPDVIEAVESDMPRLEK----NQVLVRNYAAGVNPVDTYIRAGQYGK 62

  Fly   106 TVLNKMRCQPG-DGIEFPLILGREFCGELVQTGMGVSLPLGSRVWGVVPLQATIGSHAEYVAVPS 169
              |..:...|| ||..|.     |..||.|:     ::.:|.|||    ..:...|.||||||  
 Worm    63 --LPNLPYVPGKDGAGFV-----ELVGESVK-----NVKVGDRVW----YGSEADSTAEYVAV-- 109

  Fly   170 YCLAPAPKELDD----YEAASVLYAGLTAWSGLYITGGLGGPCGATTASGGGAHKRVLVLGGSGG 230
                ..|.||.:    .|.||:....|||:..|:...|         |..|..   :||.|.|||
 Worm   110 ----NRPFELPEGVSFEEGASLGVPYLTAYRALFHLAG---------AKTGDV---ILVHGASGG 158

  Fly   231 VGTLAIQILKSQKVQVLATC-SENAIEMVRNLGADLVVDYNNPQAMEELCKYAPYDIVLDCAGQG 294
            ||:..:|:...:.::.:.|. |.:.|..|::|||..|.::::.|.:.::....|          |
 Worm   159 VGSALMQLAAWRNIEAVGTAGSADGIRFVKSLGARNVYNHSDKQYVSKMKNDYP----------G 213

  Fly   295 GQKAAESKYDFRQYITFSSPLLANIDKQGLGV----GALKNVFDLFQTNVRS----VTQRGGL-- 349
            |         |......::....|.|   ||:    |.:..:.:..:|.:.:    ||: |.:  
 Worm   214 G---------FNHIFEMAAHTNLNTD---LGLLAPRGRVAVIGNRAETTINARQLMVTE-GAVYG 265

  Fly   350 VKWGFFSPAPQ---GIQFLQKLVEQRKLMPLIDSSYGFSELPKAFEK-MKSGHLRGKIVVKL 407
            |..|..|.|..   ||..: ..:::.:..|||:..|...:|..|.|: |.:...:|.:||::
 Worm   266 VALGMSSEAELLDFGINIV-SFLKETEFRPLINKLYRLEQLGLAHEEIMNNKGAKGNLVVQI 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 100/376 (27%)
Qor 52..406 CDD:223677 100/376 (27%)
F39B2.3NP_493577.1 Qor 10..326 CDD:223677 101/377 (27%)
zeta_crystallin 10..326 CDD:176215 101/377 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3553
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.