DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and ccdc85c

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001072445.1 Gene:ccdc85c XenbaseID:XB-GENE-5853436 Length:391 Species:Xenopus tropicalis

Alignment Length:348 Identity:135/349 (39%)
Similarity:195/349 (56%) Gaps:63/349 (18%)


  Fly   283 GRLTAEQNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTAS 347
            |.:..:.||:||..::|:|.|||.||:|.|||||||:||||||||||||:||:||||||||::|:
 Frog    48 GNMMKDVNRRLQVHLHEIRGLKEVNQKLQDDNQELRELCCFLDDDRQKGKKLSREWQRFGRHSAT 112

  Fly   348 VMRQEVAAYQNKLRQLDDKQQELITDNLELKELCLYLDEERAHVAANALCAGCGAATRNAL---- 408
            :|.:||..||.||::|:.||:.||.|||||||:.|.|||||.           ||.:|:::    
 Frog   113 MMWKEVGVYQQKLKELEAKQESLIRDNLELKEIILMLDEERN-----------GAGSRSSIDSQN 166

  Fly   409 -----------RDDGDGSSSSTN------------------ADETITALRNYAEQRQLPQDLRH- 443
                       ||.|||||:|:.                  .:.....:|...:...:|...|. 
 Frog   167 SLTNLNGSSGPRDVGDGSSTSSTGSAGSPDHHHHHHHHTKPTENKAGTVRKSTDDLSIPPHHRSI 231

  Fly   444 AHTLNDQTLQYVRSLERRIQQLEEERTTPTAHLQQPTTPTPQATPTPTVTSAATP--AKSAASPH 506
            .:.|||.:..|:|.||.|::.||::...    |.|.:|    :....|:....:|  ::|..||.
 Frog   232 PNGLNDSSTTYIRQLETRVKLLEDDNKL----LSQHST----SGELRTLRKGLSPYHSESQLSPL 288

  Fly   507 QQQQQQQQHQQQQQDIVAAAAAAAAAIQLPEPIAGRPEAVVRALQVLEVREQLERDRLGNLAGSA 571
            .|.|:..|:...:.....::.|.|..|    |:..:|||||.|::||||.|.|:|    .::.:.
 Frog   289 PQYQEPLQNGSTRVTPEISSTAPAGYI----PVVQKPEAVVHAMKVLEVHENLDR----QMSDTY 345

  Fly   572 LDQMDDGEKALVREMCNVVWRKL 594
            .:.:.:.|||:||||||||||||
 Frog   346 EEDLSEKEKAIVREMCNVVWRKL 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 68/106 (64%)
ccdc85cNP_001072445.1 CCDC85 10..180 CDD:313454 73/143 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3819
Hieranoid 1 1.000
Homologene 1 1.000 H82238
Inparanoid 1 1.050 213 1.000 Inparanoid score I3421
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393196at2759
OrthoFinder 1 1.000 FOG0001232
OrthoInspector 1 1.000 T601843
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3355
TreeFam 1 0.960
98.950

Return to query results.
Submit another query.