DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and ccdc85b

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001165771.1 Gene:ccdc85b XenbaseID:XB-GENE-5772343 Length:201 Species:Xenopus tropicalis

Alignment Length:144 Identity:70/145 (48%)
Similarity:94/145 (65%) Gaps:14/145 (10%)


  Fly   283 GRLTAEQNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTAS 347
            |||..|.|||||..:.|:|.||:.|.||.::|:||:||||||||||.|.:|||.|||.||.:.|.
 Frog    47 GRLIKEVNRQLQGHLTEIRELKQVNHRLQEENRELKDLCCFLDDDRLKSKKLASEWQLFGYHAAK 111

  Fly   348 VMRQEVAAYQNKLRQLDDKQQELITDNLELKELCLYLDEE----RAH---VAANAL-CAGCGAAT 404
            |:|:::..|..||.:|:.:|:||:.:|..|.|:.|.|:|:    |.|   |||:.| ...||.  
 Frog   112 VLREDLGGYLKKLSELERRQEELMRENSCLSEVFLALEEDSGPIRHHASPVAASELSLLPCGP-- 174

  Fly   405 RNALRDDGDGSSSS 418
                ||.||||||:
 Frog   175 ----RDLGDGSSST 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 55/110 (50%)
ccdc85bNP_001165771.1 DUF2216 9..177 CDD:287229 64/136 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393196at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.