DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and ccdc85ca

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001038849.1 Gene:ccdc85ca ZFINID:ZDB-GENE-060825-198 Length:391 Species:Danio rerio

Alignment Length:417 Identity:144/418 (34%)
Similarity:212/418 (51%) Gaps:92/418 (22%)


  Fly   224 DSIKQQQQQQQQQQSRYLPAHQPGAKDMLKFVRKPDQEHPSPNASVTSSGTGIPTANGGGRLTAE 288
            |.:.:...::.|:.|:         :::|:.:||.|.|  ..|..:..           |.:..:
Zfish    11 DDLSKVSDEELQKCSK---------EELLRRLRKVDAE--KMNLMLEH-----------GNMMKD 53

  Fly   289 QNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVMRQEV 353
            .||:||..::|:|:|||.||:|.:||||||:||||||||||||:||:||||||||||||||.:||
Zfish    54 VNRRLQLHLHEIRSLKEVNQKLQEDNQELRELCCFLDDDRQKGKKLSREWQRFGRYTASVMWKEV 118

  Fly   354 AAYQNKLRQLDDKQQELITDNLELKELCLYLDEERAHVAANALCAGCGAATRNAL---------- 408
            ..:|.||::|:..|..::.:||||||:.:.||:||.           ||.:|:::          
Zfish   119 GVFQQKLKELESNQDSVMRENLELKEIIIMLDDERN-----------GAGSRSSIDSQSSLSNLN 172

  Fly   409 ------RDDGDGSSSSTN----------------ADETITALRNYAEQRQLPQDLRH-AHTLNDQ 450
                  ||.|||||:|:.                .:..||::|...:.......||: .:.|||.
Zfish   173 GGSATVRDVGDGSSTSSTGSAGSPDHHHSHIHKPTEGKITSIRRSMDDLSTNHLLRNIPNGLNDS 237

  Fly   451 TLQYVRSLERRIQQLEEERTTPTAHLQQPTTPTPQATPTPTVTSAATPAKSAASPHQQQQ----Q 511
            :..|:|.||.:::.||::.....:  ||           .:|....|..|..:..|.:.|    .
Zfish   238 SSNYIRQLETKVRILEDDNKQLLS--QQ-----------GSVGDLKTLRKGLSLYHSESQLSSLS 289

  Fly   512 QQQHQQQQQDIVAAAAAAAAAIQLPEPIAGRPEAVVRALQVLEVREQLERDRLGNLAGSALDQMD 576
            |.|...|...|..|....|..:....|.|.:|||||.|::||||.|.|:|    .:.....:.:.
Zfish   290 QFQDTLQNGSIRIAGGDLAPTVTGYLPAAQKPEAVVHAMKVLEVHENLDR----KIPEDYEEDLS 350

  Fly   577 DGEKALVREMCNVVWRKLEGSPHGPAA 603
            :.|||:||||||||||||     |.||
Zfish   351 EKEKAIVREMCNVVWRKL-----GDAA 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 64/106 (60%)
ccdc85caNP_001038849.1 DUF2216 10..181 CDD:287229 78/203 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3819
Hieranoid 1 1.000
Homologene 1 1.000 H82238
Inparanoid 1 1.050 201 1.000 Inparanoid score I3666
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393196at2759
OrthoFinder 1 1.000 FOG0001232
OrthoInspector 1 1.000 T597684
orthoMCL 1 0.900 OOG5_135635
Panther 1 1.100 LDO PTHR13546
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3355
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.950

Return to query results.
Submit another query.