DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and Ccdc85c

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_006240615.1 Gene:Ccdc85c RGDID:1589818 Length:305 Species:Rattus norvegicus

Alignment Length:410 Identity:99/411 (24%)
Similarity:153/411 (37%) Gaps:144/411 (35%)


  Fly   211 PPDIPQLSSIYIPDSIKQQQQQQQQQQSRYLPAHQPGAKDMLKFVRKPDQEHPSPNASVTSSGTG 275
            ||.:...::....:.:.|...::..:.|:         :::.:.:|:.:.|.           .|
  Rat     4 PPAVAAAAAAAASEELSQVPDEELLRWSK---------EELARRLRRAEGEK-----------VG 48

  Fly   276 IPTANGGGRLTAEQNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCF------LDDDRQKGRKL 334
            :...:||  |..:.||:||..:.|:|.||:.||||.|||||||:||||      |.....||.: 
  Rat    49 LMLEHGG--LMRDVNRRLQQHLLEIRGLKDVNQRLQDDNQELRELCCFHVPPALLPPGPHKGPE- 110

  Fly   335 AREWQRFGRYTASVMRQEVAAYQNKLRQLDDKQQELITDNLELKELCLYLDEERAHVAANALCAG 399
                                                                            |
  Rat   111 ----------------------------------------------------------------G 111

  Fly   400 CGAATRNALRDDGDGSSSSTNADETITALRNYAEQRQLPQDLRHAHTLNDQTLQYVRSLERRIQQ 464
            ...|||.:|.|                 |......|.:|      :.|:|.:..|:|.||.:::.
  Rat   112 KAGATRRSLDD-----------------LSAPPHHRSIP------NGLHDPSSTYIRPLETKVKL 153

  Fly   465 LEEERTTPTAHLQQPTTPTPQATPTPTVTSAAT----PAKSAASPHQQQQQQQQHQQQQQDIVAA 525
            |:.::.       .|..|.|.......:..|.:    ..:...||:..:.|........|:::..
  Rat   154 LDGDKL-------PPQLPRPYGLQRSRLQQAGSGEFRTLRKGFSPYHSESQLASLPPSYQEVLQN 211

  Fly   526 AAAAAAAIQLPEP------IAG-RPEAVVRALQVLEVREQLERDRLGNLAGSALDQMDDGEKALV 583
            ..|.... :||.|      .|| :|||||.|::||||.|.|:|    .|..|..:.:.:.|||:|
  Rat   212 GPACPVP-ELPSPPSTVYSSAGQKPEAVVHAMKVLEVHENLDR----QLQDSCEEDLSEKEKAIV 271

  Fly   584 REMCNVVWRKLEGSPHGPAA 603
            |||||||||||     |.||
  Rat   272 REMCNVVWRKL-----GDAA 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 27/112 (24%)
Ccdc85cXP_006240615.1 DUF2216 16..>94 CDD:287229 30/100 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H82238
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393196at2759
OrthoFinder 1 1.000 FOG0001232
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.