DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and Ccdc85c

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_006516221.1 Gene:Ccdc85c MGIID:3644008 Length:433 Species:Mus musculus

Alignment Length:450 Identity:152/450 (34%)
Similarity:220/450 (49%) Gaps:96/450 (21%)


  Fly   211 PPDIPQLSSIYIPDSIKQQQQQQQQQQSRYLPAHQPGAKDMLKFVRKPDQEHPSPNASVTSSGTG 275
            ||.:...::....:.:.|...::..:.|:         :::.:.:|:.:.|.           .|
Mouse     4 PPAVAAAAAAAASEELSQVPDEELLRWSK---------EELARRLRRAEGEK-----------VG 48

  Fly   276 IPTANGGGRLTAEQNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQR 340
            :...:||  |..:.||:||..:.|:|.||:.||||.|||||||:|||||||||||||||||||||
Mouse    49 LMLEHGG--LMRDVNRRLQQHLLEIRGLKDVNQRLQDDNQELRELCCFLDDDRQKGRKLAREWQR 111

  Fly   341 FGRYTASVMRQEVAAYQNKLRQLDDKQQELITDNLELKELCLYLDEERAHVAA--NALCAGCGAA 403
            |||:.|..:..|||..|.|||:|:.:|:.|:.:|||||||.|.||||||.:||  .|...|.||.
Mouse   112 FGRHAAGAVWHEVARSQQKLRELEARQEALLRENLELKELVLLLDEERAALAAAGGAGGGGGGAG 176

  Fly   404 TRNAL-------------------RDDGDGSSSSTNA------------------------DETI 425
            :|:::                   ||.|||||:|:..                        |...
Mouse   177 SRSSIDSQASLSGPLAGSAAGSGARDVGDGSSTSSAGSGGSPDHHHHVPAALLPPGPHKVPDGKA 241

  Fly   426 TALRNYAEQRQLPQDLRH-AHTLNDQTLQYVRSLERRIQQLEEERTTPTAHLQQPTTPTPQATPT 489
            .|.|...:....|...|. .:.|:|.:..|:|.||.:::.|:.::.       .|..|.|.:...
Mouse   242 GATRRSLDDLSAPPHHRSIPNGLHDPSSTYIRPLETKVKLLDGDKL-------PPQLPRPHSCQR 299

  Fly   490 PTVTSAAT----PAKSAASPHQQQQQQQQHQQQQQDIVAAAAAAAAAIQLPEP------IAG-RP 543
            ..:..|.:    ..:...||:..:.|........|:::....|.... :||.|      .|| :|
Mouse   300 SQLQQAGSGEFRTLRKGFSPYHSESQLASLPPSYQEVLQNGPACPVP-ELPSPPSTVYSSAGQKP 363

  Fly   544 EAVVRALQVLEVREQLERDRLGNLAGSALDQMDDGEKALVREMCNVVWRKLEGSPHGPAA 603
            ||||.|::||||.|.|:|    .|..|..:.:.:.|||:||||||||||||     |.||
Mouse   364 EAVVHAMKVLEVHENLDR----QLQDSCEEDLSEKEKAIVREMCNVVWRKL-----GDAA 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 68/106 (64%)
Ccdc85cXP_006516221.1 DUF2216 16..203 CDD:287229 85/209 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3819
Hieranoid 1 1.000
Homologene 1 1.000 H82238
Inparanoid 1 1.050 196 1.000 Inparanoid score I3783
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393196at2759
OrthoFinder 1 1.000 FOG0001232
OrthoInspector 1 1.000 T616808
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13546
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3355
TreeFam 1 0.960
1010.050

Return to query results.
Submit another query.