DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and ccdc85b

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001159626.1 Gene:ccdc85b ZFINID:ZDB-GENE-060130-56 Length:200 Species:Danio rerio

Alignment Length:140 Identity:74/141 (52%)
Similarity:93/141 (66%) Gaps:7/141 (5%)


  Fly   283 GRLTAEQNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTAS 347
            |||..|.|:|||..:.|:|.||..||||.::|||||||||||||||.|.:|||||||.||.:.|.
Zfish    47 GRLIKEVNKQLQGHLLEIRELKVINQRLQEENQELRDLCCFLDDDRLKVKKLAREWQLFGHHAAK 111

  Fly   348 VMRQEVAAYQNKLRQLDDKQQELITDNLELKELCLYLDEERAHVAANALCAGCGAATRN----AL 408
            |||:::..|..||..|:..|..|:.:||:||||||.|:||  .|:.:....| |:...|    ..
Zfish   112 VMREDLGGYLKKLADLERMQDGLVKENLDLKELCLVLEEE--CVSRSDSSPG-GSTDLNIPCMVA 173

  Fly   409 RDDGDGSSSS 418
            ||.||||||:
Zfish   174 RDVGDGSSST 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 62/106 (58%)
ccdc85bNP_001159626.1 DUF2216 9..175 CDD:287229 67/131 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393196at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13546
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3355
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.140

Return to query results.
Submit another query.