DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccdc85 and ccdc85al

DIOPT Version :9

Sequence 1:NP_608734.2 Gene:Ccdc85 / 33509 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_009300401.1 Gene:ccdc85al / 447831 ZFINID:ZDB-GENE-040912-92 Length:443 Species:Danio rerio


Alignment Length:349 Identity:114/349 - (32%)
Similarity:168/349 - (48%) Gaps:67/349 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 PQPATGILKPHLPLKYPPDIPQLSSIYIPDSIKQQQQQQQQQQSRYLPAHQPGAKDMLKFVRKPD 259
            ||...|...|..|.:   ||..|:.    :.:.|..:::..|:.|...|      |.:..:    
Zfish     5 PQAQPGSKAPESPAE---DIANLTD----EELLQWSKEELVQRLRRCEA------DKMSVI---- 52

  Fly   260 QEHPSPNASVTSSGTGIPTANGGGRLTAEQNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCFL 324
            .:|                    ..|..|.||.||..:||:|.|||.||:|.|||:|||||||||
Zfish    53 LDH--------------------SNLIREVNRSLQLHLNEIRGLKEVNQKLQDDNRELRDLCCFL 97

  Fly   325 DDDRQKGRKLAREWQRFGRYTASVMRQEVAAYQNKLRQLDDKQQELITDNLELKELCLYLDEERA 389
            |||||||::::|||||.||::|||||:|||.|..||.:|:.||:::|.:||||:||||.:||::.
Zfish    98 DDDRQKGKRVSREWQRLGRFSASVMRKEVALYLQKLTELERKQEDVIRENLELRELCLLIDEDKG 162

  Fly   390 HVAANALCAGCGA-ATRNA------------LRDDGDGSSSSTNADETITALRNYAEQRQLPQDL 441
            ......:.:|.|. ..||:            :||.|||||:|:......::...:.:|.|.|...
Zfish   163 GGGVEGVQSGTGTIGCRNSIDSQSGLLVPGLMRDVGDGSSTSSAGSADSSSEHPHHKQPQPPSST 227

  Fly   442 RHAHTLNDQTLQYVRSLER------RIQQLE---EERTTPTAH---LQQPTTPT--PQATPTPTV 492
            ...:...|  :|..|||:|      .|...:   ..|:|...:   |.||..|.  ..:.|...:
Zfish   228 GTGNKSPD--IQKSRSLKRGEGDHGEISSPDPPVRHRSTSLEYPFVLPQPCRPRCGSISVPDHRL 290

  Fly   493 TSAATPAKSAAS-PHQQQQQQQQH 515
            ....:|.|...| .|:..:...:|
Zfish   291 IRGLSPEKYGRSLGHRSPETHPKH 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccdc85NP_608734.2 DUF2216 <283..389 CDD:287229 66/105 (63%)
ccdc85alXP_009300401.1 DUF2216 18..197 CDD:287229 80/215 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4209
eggNOG 1 0.900 - - E1_KOG3819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3732
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393196at2759
OrthoFinder 1 1.000 - - FOG0002221
OrthoInspector 1 1.000 - - otm24666
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13546
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1655
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.