DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and ccdc85cb

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001002628.1 Gene:ccdc85cb ZFINID:ZDB-GENE-040718-373 Length:399 Species:Danio rerio

Alignment Length:393 Identity:133/394 (34%)
Similarity:198/394 (50%) Gaps:87/394 (22%)


  Fly   249 KDMLKFVRKPDQEHPSPNASVTSSGTGIPTANGGGRLTAEQNRQLQSLVNELRALKEQNQRLLDD 313
            :|:::.:|:.|.|..|.....::             :..:.||.||..::|:|.|||.||:|.||
Zfish    24 EDLIRRLRRVDGEKMSLMLEHSN-------------MMKDVNRSLQVHLHEIRNLKEINQKLQDD 75

  Fly   314 NQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVMRQEVAAYQNKLRQLDDKQQELITDNLELK 378
            |||||:||||||||||||:||:|||||||::|||.:.:||:.||.||::|:..|:.::.:|.|||
Zfish    76 NQELRELCCFLDDDRQKGKKLSREWQRFGKFTASSVWKEVSTYQQKLKELEINQENVLRENAELK 140

  Fly   379 ELCLYLDEERAHVAANALCAGCGAATRNAL----------------RDDGDGSSSSTNAD----- 422
            ::.|.|||:|.           ||.:|:::                ||.|||||:|:...     
Zfish   141 DIILMLDEDRN-----------GAGSRSSIDSQSSLSNLNGGSGTVRDVGDGSSTSSGGSAGSPD 194

  Fly   423 -------ETITA----LRNYAEQRQLPQDLRHAHT-----LNDQTLQYVRSLERRIQQLEEERTT 471
                   :|:.|    :|...:....|    |.|.     |||.:..|:|.||.:::.||:..  
Zfish   195 HHHNHIHKTVEAKIGTVRRSMDDLSAP----HHHRSIPAGLNDASSNYIRQLETKVRILEDNN-- 253

  Fly   472 PTAHLQQPTTPTPQATPTPTVTSAATPA--KSAASPHQQQQQQQQHQQQQQDIVAAAAAAAAAIQ 534
             ...|.||.:....:..:.........|  |.....|.:.|.....|:|:     |.......:|
Zfish   254 -NKLLSQPCSRYSLSKLSMKYNPGDLRALRKGMTLYHSESQLSSLPQRQE-----ALLNGTGRLQ 312

  Fly   535 LPE--PIAG------RPEAVVRALQVLEVREQLERDRLGNLAGSALDQMDDGEKALVREMCNVVW 591
            ..|  |..|      :|||||.|::||||.:.||:    .|...:.:.:.:.|||:|||||||||
Zfish   313 TSESSPSTGFISSAQKPEAVVHAMKVLEVHDNLEK----QLPEESEEDLSEKEKAIVREMCNVVW 373

  Fly   592 RKL 594
            |||
Zfish   374 RKL 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 60/106 (57%)
ccdc85cbNP_001002628.1 DUF2216 7..178 CDD:287229 70/178 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3819
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3666
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393196at2759
OrthoFinder 1 1.000 FOG0001232
OrthoInspector 1 1.000 T597684
orthoMCL 1 0.900 OOG5_135635
Panther 1 1.100 LDO PTHR13546
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3355
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.950

Return to query results.
Submit another query.