DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and picc-1

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_504560.1 Gene:picc-1 WormBaseID:WBGene00017931 Length:535 Species:Caenorhabditis elegans

Alignment Length:396 Identity:107/397 (27%)
Similarity:171/397 (43%) Gaps:104/397 (26%)


  Fly   111 QQQQQQSHQLQTVATIHQPHSTQQQALTSRLPIQQQSTKELPNLAGQQRRSFHYQLQNQQQSLRS 175
            ::....|....:.:|:|     ..:.:...:|:...:|..  ::......|..|....:|...||
 Worm     7 RRANMSSESGSSASTVH-----YAKPVLRHVPMPSSTTPS--SIGSSSSSSSSYASSTKQTPPRS 64

  Fly   176 PQLKAP----------APAHSIPPRYQPPPQPATGILKPHLPLKYPPDIPQLSSIYIPDSIKQQQ 230
            |.::.|          .|:.|:.|:..|                         |..:|.|..|.|
 Worm    65 PVIRYPTVVVSKNSIATPSSSLTPQGTP-------------------------SYAVPVSRNQMQ 104

  Fly   231 QQQQQQQSRYLPAHQPGAKDMLKFVRKPDQEHPSPNASVTSSGTGIPTANGGGRLTAEQNRQLQS 295
            ....:.|..::       :...|.:...:|:.....:.|.:                :.||::|.
 Worm   105 YSASKLQYEHM-------RHRCKMLDDENQKLMRMQSDVVN----------------DANRRVQM 146

  Fly   296 LVNELRALKEQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVMRQEVAAYQNKL 360
            .|||:|.|||.|::|...|:|||||.|||||||||.||||||||:|||||:|:|:|||.:|..|:
 Worm   147 HVNEIRMLKEDNRKLAISNKELRDLSCFLDDDRQKTRKLAREWQKFGRYTSSLMKQEVDSYHQKM 211

  Fly   361 RQLDDK--QQELITDNLELKELCLYLDEER----AHVAANALC------AGCGAATRNALRDDGD 413
            ..:::|  .:|...|  ||::||:||||:|    ::.|||..|      .|||::.::       
 Worm   212 VSIEEKLCTKEREVD--ELRQLCMYLDEQRQSLMSNAAANVDCDNESEDLGCGSSEQS------- 267

  Fly   414 GSSSSTNADE------------------TITALRNYAEQRQLPQDLRHAHTLNDQTLQYVRSLER 460
            |.|...|.:|                  .|.|....:|..:..:....:.....:.|.|::|||.
 Worm   268 GGSEGHNDEEKHHEFNKCFNKHKESTLRRIMATSMCSEPSEEEERREVSKRERSRLLGYIQSLEN 332

  Fly   461 RIQQLE 466
            ||:.||
 Worm   333 RIKHLE 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 59/112 (53%)
picc-1NP_504560.1 DUF2216 113..239 CDD:287229 61/151 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001232
OrthoInspector 1 1.000 T475310
orthoMCL 1 0.900 OOG5_135635
Panther 1 1.100 LDO PTHR13546
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3355
TreeFam 1 0.960
76.890

Return to query results.
Submit another query.