DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and CCDC85C

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_011535007.1 Gene:CCDC85C HGNCID:35459 Length:432 Species:Homo sapiens

Alignment Length:389 Identity:150/390 (38%)
Similarity:199/390 (51%) Gaps:79/390 (20%)


  Fly   275 GIPTANGGGRLTAEQNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQ 339
            |:...:||  |..:.||:||..:.|:|.||:.||||.|||||||:||||||||||||||||||||
Human    44 GLMLEHGG--LMRDVNRRLQQHLLEIRGLKDVNQRLQDDNQELRELCCFLDDDRQKGRKLAREWQ 106

  Fly   340 RFGRYTASVMRQEVAAYQNKLRQLDDKQQELITDNLELKELCLYLDEERAHVAANALCA-----G 399
            ||||:.|..:..|||..|.|||:|:.:|:.|:.:|||||||.|.||||||.:||....:     |
Human   107 RFGRHAAGAVWHEVARSQQKLRELEARQEALLRENLELKELVLLLDEERAALAATGAASGGGGGG 171

  Fly   400 CGAATRNAL-------------------RDDGDGSSSSTNA------------------------ 421
            .||.:|:::                   ||.|||||:|:..                        
Human   172 GGAGSRSSIDSQASLSGPLSGGAPGAGARDVGDGSSTSSAGSGGSPDHHHHVPPPLLPPGPHKAP 236

  Fly   422 DETITALRNYAEQRQLPQDLRH-AHTLNDQTLQYVRSLERRIQQLEEERTTPTAHLQQPTTPTPQ 485
            |....|.|...:....|...|. .:.|:|.:..|:|.||.:::.||.::.     |.|  .|.|.
Human   237 DGKAGATRRSLDDLSAPPHHRSIPNGLHDPSSTYIRQLESKVRLLEGDKL-----LAQ--LPRPY 294

  Fly   486 ATPTPTVTSAAT----PAKSAASPHQQQQQQQQHQQQQQDIVAAAAAAAAAIQLPE-PIAG---- 541
            ..|...:..|.:    ..:...||:..:.|........||.:....|..|. :||. |.||    
Human   295 GRPRSWLQQAGSGEFRTLRKGFSPYHSESQLASLPPSYQDSLQNGPACPAP-ELPSPPSAGYSPA 358

  Fly   542 --RPEAVVRALQVLEVREQLERDRLGNLAGSALDQMDDGEKALVREMCNVVWRKLEGSPHGPAA 603
              :|||||.|::||||.|.|:|    .|..|..:.:.:.|||:||||||||||||     |.||
Human   359 GQKPEAVVHAMKVLEVHENLDR----QLQDSCEEDLSEKEKAIVREMCNVVWRKL-----GDAA 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 68/106 (64%)
CCDC85CXP_011535007.1 DUF2216 12..202 CDD:287229 80/160 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3819
Hieranoid 1 1.000
Homologene 1 1.000 H82238
Inparanoid 1 1.050 196 1.000 Inparanoid score I3757
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393196at2759
OrthoFinder 1 1.000 FOG0001232
OrthoInspector 1 1.000 T609997
orthoMCL 1 0.900 OOG5_135635
Panther 1 1.100 LDO PTHR13546
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3355
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.950

Return to query results.
Submit another query.