DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and Ccdc85b

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_006223675.1 Gene:Ccdc85b RGDID:1565319 Length:202 Species:Rattus norvegicus

Alignment Length:143 Identity:68/144 (47%)
Similarity:92/144 (64%) Gaps:7/144 (5%)


  Fly   283 GRLTAEQNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTAS 347
            |||..|.|||||..:.|:|.||:.|:||..:|:||||||||||.:||:||:.||:||.||...:.
  Rat    43 GRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASR 107

  Fly   348 VMRQEVAAYQNKLRQLDDKQQELITDNLELKELCLYLDEERAHVA--ANALCAGCGAATRNAL-- 408
            .:|:::.....||.:|:.:|:||:.:||.||||||.|.||.....  ..|:.:|.|.....||  
  Rat   108 AVREDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPGGAVGSGAGPTPELALPP 172

  Fly   409 ---RDDGDGSSSS 418
               ||.||||||:
  Rat   173 CGPRDLGDGSSST 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 55/106 (52%)
Ccdc85bXP_006223675.1 CCDC85 5..178 CDD:313454 62/135 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393196at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.