DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and Ccdc85a

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001178482.1 Gene:Ccdc85a RGDID:1311700 Length:545 Species:Rattus norvegicus

Alignment Length:314 Identity:110/315 (35%)
Similarity:164/315 (52%) Gaps:66/315 (21%)


  Fly   249 KDMLKFVRKPDQEHPSPNASVTSSGTGIPTANGGGRLTAEQNRQLQSLVNELRALKEQNQRLLDD 313
            :|:::.:|:.:.|..|  |.:..|           .|..|.||:||..:.|:|.||:.||:|.:|
  Rat    45 EDLIRSLRRAEAEKVS--AMLDHS-----------NLIREVNRRLQLHLGEIRGLKDINQKLQED 96

  Fly   314 NQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVMRQEVAAYQNKLRQLDDKQQELITDNLELK 378
            ||||||||||||||||||::::|||||.|||||.||.:|||.|..||::|:.||:|::.:|:|||
  Rat    97 NQELRDLCCFLDDDRQKGKRVSREWQRLGRYTAGVMHKEVALYLQKLKELEVKQEEVVKENMELK 161

  Fly   379 ELCLYLDEERAHVAANALCA--------GCGAATRNALRDDGDGSS-SSTNADETITALRNYAEQ 434
            |||:.||||:....|.:.|:        ...|:....:||.||||| |||.:.::          
  Rat   162 ELCVLLDEEKGTGCAGSRCSIDSQASLCQLVASAAPYVRDVGDGSSTSSTGSTDS---------- 216

  Fly   435 RQLPQDLR-HAHTLNDQTLQYVRSLERRIQQLEEERTTPTAHLQQPTTPTPQATPTPTVTSAATP 498
               |...: ||...:.:.||..||  ....:..:.|:|...||.:     |:|:.||....|   
  Rat   217 ---PDHHKHHASGGSPEHLQKPRS--EGSPEHNKHRSTSPEHLHK-----PRASGTPDHPKA--- 268

  Fly   499 AKSAASPHQQ-------QQQQQQHQQQQQDIVAAAAAAAAAIQLPE-PIAGRPE 544
            .|..:..|.:       :||:..|.....::            ||: .::|.||
  Rat   269 LKGPSPEHHKPLCKGSPEQQRHPHPGSSPEM------------LPKHKLSGSPE 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 65/106 (61%)
Ccdc85aNP_001178482.1 DUF2216 29..202 CDD:287229 76/170 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393196at2759
OrthoFinder 1 1.000 FOG0001232
OrthoInspector 1 1.000 T618923
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13546
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.