DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and Ccdc85a

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_006514717.1 Gene:Ccdc85a MGIID:2445069 Length:578 Species:Mus musculus

Alignment Length:625 Identity:159/626 (25%)
Similarity:234/626 (37%) Gaps:272/626 (43%)


  Fly   182 APAHSIPPRYQPPPQPA-----TGILKPHLPLKYPPDIPQLSSIYIPDSIKQQQQQQQQQQSRYL 241
            |...|.|.....|..||     ||:                      |.:.:...::..|.|:  
Mouse     4 AAGGSAPAAESCPSAPAGASTPTGV----------------------DDLSKVTDEELLQWSK-- 44

  Fly   242 PAHQPGAKDMLKFVRKPDQEHPSPNASVTSSGTGIPTANGGGRLTAEQNRQLQSLVNELRALKEQ 306
                   :::::.:|:.:.|..|  |.:..|           .|..|.||:||..:.|:|.||:.
Mouse    45 -------EELIRSLRRAEAEKVS--AMLDHS-----------NLIREVNRRLQLHLGEIRGLKDI 89

  Fly   307 NQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVMRQEVAAYQNKLRQLDDKQQELI 371
            ||:|.:|||||||||||||||||||::::|||||.|||||.||.:|||.|..||::|:.||:|::
Mouse    90 NQKLQEDNQELRDLCCFLDDDRQKGKRVSREWQRLGRYTAGVMHKEVALYLQKLKELEVKQEEVV 154

  Fly   372 TDNLELKELCLYLDEERAHVAAN---------ALCAGCGAATRNALRDDGDGSS-SSTNADETIT 426
            .:|:||||||:.||||:....|.         :||....:|| ..:||.||||| |||.:.::..
Mouse   155 KENMELKELCMLLDEEKGVGCAGSRCSIDSQASLCQLVASAT-PYVRDVGDGSSTSSTGSTDSPD 218

  Fly   427 ALRNYA-----EQRQ-------------------------------------------------- 436
            ..:::|     |..|                                                  
Mouse   219 HHKHHASGGSPEHLQKPRSEGSPEHTKHRSTSPEHLHKPRASGTPDHSKALKGPSPEHHKPLCKG 283

  Fly   437 LPQDLRHAHT------------------------------------------------------- 446
            .|:..||.|.                                                       
Mouse   284 SPEQQRHPHPGSSPEVLPKHVLSGSPEHFQKHRPGGSPEHTRHSGGSPEHLQKHALGGSLEHLPR 348

  Fly   447 -------------------------------------------------------LNDQTLQYVR 456
                                                                   :|:.||.|||
Mouse   349 ARGTSPEHLKQHYGASPDHKHASGSGGSGGGSREGTLRRPAQEDSSSHHRNVYSGMNESTLSYVR 413

  Fly   457 SLERRIQQLEEERTTPTAHLQQPTTPTPQATPTPTVTSAATPAKSAASPHQ----QQQQQQQHQQ 517
            .||.|::|||||...           .||||.    ..:..|.:::::..:    :.::..|..|
Mouse   414 QLEARVRQLEEENRM-----------LPQATQ----NRSQPPTRNSSNMEKGWGPRARRVLQWWQ 463

  Fly   518 QQQDI-------------VAAAAAAAAAIQLPEPIAG------RPEAVVRALQVLEVREQLERDR 563
            ..:.|             .:.|....:::..|...:|      :||.||.:|:||:|.|.::|.:
Mouse   464 GCRGIGRCLPSLPGSFRLSSGADGNNSSLNSPASFSGHTTPSQQPEPVVHSLKVLDVEETIDRQQ 528

  Fly   564 LGNLAGSALDQMDDGEKALVREMCNVVWRKLEGSPHGPAA 603
             |...|..|.:.   |||:||||||||||||     |.||
Mouse   529 -GKEYGHDLSET---EKAVVREMCNVVWRKL-----GDAA 559

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 65/106 (61%)
Ccdc85aXP_006514717.1 DUF2216 29..202 CDD:287229 80/196 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I3783
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001232
OrthoInspector 1 1.000 T616808
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13546
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
66.010

Return to query results.
Submit another query.