DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and CCDC85A

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001335441.1 Gene:CCDC85A HGNCID:29400 Length:586 Species:Homo sapiens

Alignment Length:637 Identity:161/638 (25%)
Similarity:231/638 (36%) Gaps:301/638 (47%)


  Fly   180 APAPAHSIPPRYQPPPQPATGILKPHLPLKYPPDIPQLSSIYIPDSIKQQQQQQQQQQSRYLPAH 244
            :||||.|    ...||.|                :..||.:         ..::..|.|:     
Human    19 SPAPAGS----SAAPPAP----------------VEDLSKV---------SDEELLQWSK----- 49

  Fly   245 QPGAKDMLKFVRKPDQEHPSPNASVTSSGTGIPTANGGGRLTAEQNRQLQSLVNELRALKEQNQR 309
                :::::.:|:.:.|..|  |.:..|           .|..|.||:||..:.|:|.||:.||:
Human    50 ----EELIRSLRRAEAEKVS--AMLDHS-----------NLIREVNRRLQLHLGEIRGLKDINQK 97

  Fly   310 LLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVMRQEVAAYQNKLRQLDDKQQELITDN 374
            |.:|||||||||||||||||||::::|||||.|||||.||.:|||.|..||:.|:.||:|::.:|
Human    98 LQEDNQELRDLCCFLDDDRQKGKRVSREWQRLGRYTAGVMHKEVALYLQKLKDLEVKQEEVVKEN 162

  Fly   375 LELKELCLYLDEERAHVAANALCAG--CG-----------AATRNALRDDGDGSS-SSTNADETI 425
            :||||||:.||||:     .|.|||  |.           |:|...:||.||||| |||.:.::.
Human   163 MELKELCVLLDEEK-----GAGCAGSRCSIDSQASLCQLTASTAPYVRDVGDGSSTSSTGSTDSP 222

  Fly   426 TALRNYAEQ-------------------------------------------------------R 435
            ...:::|..                                                       :
Human   223 DHHKHHASSGSPEHLQKPRSEGSPEHSKHRSASPEHPQKPRACGTPDRPKALKGPSPEHHKPLCK 287

  Fly   436 QLPQDLRHAHT------------------------------------------------------ 446
            ..|:..||.|.                                                      
Human   288 GSPEQQRHPHPGSSPETLPKHVLSGSPEHFQKHRSGSSPEHARHSGGSPEHLQKHALGGSLEHLP 352

  Fly   447 -----------------------------------------------------------LNDQTL 452
                                                                       :|:.||
Human   353 RARGTSPEHLKQHYGGSPDHKHGGGSGGSGGSGGGSREGTLRRQAQEDGSPHHRNVYSGMNESTL 417

  Fly   453 QYVRSLERRIQQLEEE-RTTPTAHLQQPTTPTPQATP-------------------------TPT 491
            .|||.||.|::||||| |..|.|...:...||..::.                         .||
Human   418 SYVRQLEARVRQLEEENRMLPQASQNRRQPPTRNSSNMEKGWGSRARRVLQWWQGCRGIGRCLPT 482

  Fly   492 VTSAATPAKSA----ASPHQQQQQQQQHQQQQQDIVAAAAAAAAAIQLPEPIAGRPEAVVRALQV 552
            :..:...:..|    :||:.               .|:.:..|...|.|||       ||.:|:|
Human   483 LPGSFRLSSGADGSNSSPNS---------------AASFSGHATPSQQPEP-------VVHSLKV 525

  Fly   553 LEVREQLERDRLGNLAGSALD-QMDDGEKALVREMCNVVWRKLEGSPHGPAA 603
            |:|:|.::|.:     |...: .:.:.|||:||||||||||||     |.||
Human   526 LDVQETIDRQQ-----GKEYEHDLSETEKAIVREMCNVVWRKL-----GDAA 567

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 65/106 (61%)
CCDC85ANP_001335441.1 CCDC85 34..207 CDD:313454 83/209 (40%)
DUF4045 <224..>327 CDD:330572 5/103 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001232
OrthoInspector 1 1.000 T609997
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13546
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.