DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17265 and LOC100911871

Sequence 1:NP_608734.2 Gene:CG17265 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_008762906.1 Gene:LOC100911871 RGDID:6490132 Length:288 Species:Rattus norvegicus

Alignment Length:208 Identity:87/209 (42%)
Similarity:120/209 (57%) Gaps:31/209 (15%)


  Fly   211 PPDIPQLSSIYIPDSIKQQQQQQQQQQSRYLPAHQPGAKDMLKFVRKPDQEHPSPNASVTSSGTG 275
            ||.:...::....:.:.|...::..:.|:         :::.:.:|:.:.|.           .|
  Rat     4 PPAVAAAAAAAASEELSQVPDEELLRWSK---------EELARRLRRAEGEK-----------VG 48

  Fly   276 IPTANGGGRLTAEQNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQR 340
            :...:||  |..:.||:||..:.|:|.||:.||||.|||||||:|||||||||||||||||||||
  Rat    49 LMLEHGG--LMRDVNRRLQQHLLEIRGLKDVNQRLQDDNQELRELCCFLDDDRQKGRKLAREWQR 111

  Fly   341 FGRYTASVMRQEVAAYQNKLRQLDDKQQELITDNLELKELCLYLDEERAHVAANALCAGCGAATR 405
            |||:.|..:..|||..|.|||:|:.:|:.|:.:|||||||.|.||||||.:||.....|.|.   
  Rat   112 FGRHAAGAVWHEVARSQQKLRELEARQEALLRENLELKELVLLLDEERAALAAAGGAGGSGG--- 173

  Fly   406 NALRDDGDGSSSS 418
                  |.||.||
  Rat   174 ------GAGSRSS 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17265NP_608734.2 DUF2216 <283..389 CDD:287229 68/106 (64%)
LOC100911871XP_008762906.1 DUF2216 16..>143 CDD:287229 62/149 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1393196at2759
OrthoFinder 1 1.000 FOG0001232
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.